KEGG   Shewanella sp. MR-4: Shewmr4_3011Help
Entry
Shewmr4_3011      CDS       T00388                                 

Gene name
cysM
Definition
cysteine synthase B (EC:2.5.1.47)
Orthology
K12339  
cysteine synthase B [EC:2.5.1.47]
Organism
she  Shewanella sp. MR-4
Pathway
Cysteine and methionine metabolism
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Cysteine biosynthesis, serine => cysteine
Brite
KEGG Orthology (KO) [BR:she00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Shewmr4_3011 (cysM)
   01230 Biosynthesis of amino acids
    Shewmr4_3011 (cysM)
  Energy metabolism
   00920 Sulfur metabolism
    Shewmr4_3011 (cysM)
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Shewmr4_3011 (cysM)
Enzymes [BR:she01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.47  cysteine synthase
     Shewmr4_3011 (cysM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3596727..3597605)
Genome map
AA seq 292 aa AA seqDB search
MSDFPTIEACIGQTPLVRLQRLDCGSSTVLLKLEGNNPAGSVKDRAALNMIIQAELRQEI
APGDTLIEATSGNTGIALAMAAAIKGYKMILIMPSNSTQERKDAMLAYGAELLLVDNMEA
ARDLALELQAQGKGKVLDQFNNQDNANAHFQTTGPEIWQQSQGKITHFVSSMGTTGTIMG
VSKYLKSRNPDVTIVGLQPADGSSIPGIRRWPQEYLPGIFDAARVDAVMDIEEQDAKAMA
RTLAREEGICAGVSSGGAVFAALEIARQNPGSVVVAIVCDRGDRYLSSGLFS
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
gtgtctgactttccgactattgaagcctgtattgggcaaactccgctggtacgtttgcag
cgacttgattgtggtagctcaacggtattattaaagctggaggggaataaccccgcgggt
tcggtaaaggatcgcgcggcgctgaatatgattattcaggcggagcttcgccaagagatt
gcccctggggataccctgattgaagcgaccagtggcaataccggcatcgccttagccatg
gcggcggcgattaaaggctacaagatgatcctgatcatgccgtcgaattcgacccaagag
cgtaaggatgccatgctggcctatggcgccgagctgctgctggtggacaatatggaagcc
gcgcgggatttagccttagagcttcaggcacaaggcaaaggtaaggtgctggatcagttc
aataatcaagataacgccaacgcccatttccagaccactggccccgaaatttggcagcag
agccaaggtaagatcacccactttgtctccagcatgggcaccacaggcactattatgggc
gtgtcgaaatacctaaagagccgcaacccagatgtcaccattgtcgggctacaacccgcc
gatggcagttcgattccggggattcgtcgttggccgcaggaatatctaccgggtattttc
gatgctgcccgtgtcgatgcggtgatggatattgaggagcaagatgcgaaagccatggca
agaaccttggcccgtgaagaaggcatttgtgctggcgtgagttctggcggcgcggtattt
gcggcgctcgagattgcgaggcagaatccgggttcggttgtggtcgcgattgtgtgtgat
aggggcgaccgttatctgtcatctgggttattttcttaa

DBGET integrated database retrieval system