KEGG   Shewanella sp. MR-4: Shewmr4_3011Help
Entry
Shewmr4_3011      CDS       T00388                                 

Gene name
cysM
Definition
(RefSeq) cysteine synthase B (EC:2.5.1.47)
  KO
K12339  
cysteine synthase B [EC:2.5.1.47]
Organism
she  Shewanella sp. MR-4
Pathway
Cysteine and methionine metabolism
Sulfur metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Cysteine biosynthesis, serine => cysteine
Brite
KEGG Orthology (KO) [BR:she00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Shewmr4_3011 (cysM)
   01230 Biosynthesis of amino acids
    Shewmr4_3011 (cysM)
  Energy metabolism
   00920 Sulfur metabolism
    Shewmr4_3011 (cysM)
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Shewmr4_3011 (cysM)
Enzymes [BR:she01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.47  cysteine synthase
     Shewmr4_3011 (cysM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3596727..3597605)
Genome map
AA seq 292 aa AA seqDB search
MSDFPTIEACIGQTPLVRLQRLDCGSSTVLLKLEGNNPAGSVKDRAALNMIIQAELRQEI
APGDTLIEATSGNTGIALAMAAAIKGYKMILIMPSNSTQERKDAMLAYGAELLLVDNMEA
ARDLALELQAQGKGKVLDQFNNQDNANAHFQTTGPEIWQQSQGKITHFVSSMGTTGTIMG
VSKYLKSRNPDVTIVGLQPADGSSIPGIRRWPQEYLPGIFDAARVDAVMDIEEQDAKAMA
RTLAREEGICAGVSSGGAVFAALEIARQNPGSVVVAIVCDRGDRYLSSGLFS
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
gtgtctgactttccgactattgaagcctgtattgggcaaactccgctggtacgtttgcag
cgacttgattgtggtagctcaacggtattattaaagctggaggggaataaccccgcgggt
tcggtaaaggatcgcgcggcgctgaatatgattattcaggcggagcttcgccaagagatt
gcccctggggataccctgattgaagcgaccagtggcaataccggcatcgccttagccatg
gcggcggcgattaaaggctacaagatgatcctgatcatgccgtcgaattcgacccaagag
cgtaaggatgccatgctggcctatggcgccgagctgctgctggtggacaatatggaagcc
gcgcgggatttagccttagagcttcaggcacaaggcaaaggtaaggtgctggatcagttc
aataatcaagataacgccaacgcccatttccagaccactggccccgaaatttggcagcag
agccaaggtaagatcacccactttgtctccagcatgggcaccacaggcactattatgggc
gtgtcgaaatacctaaagagccgcaacccagatgtcaccattgtcgggctacaacccgcc
gatggcagttcgattccggggattcgtcgttggccgcaggaatatctaccgggtattttc
gatgctgcccgtgtcgatgcggtgatggatattgaggagcaagatgcgaaagccatggca
agaaccttggcccgtgaagaaggcatttgtgctggcgtgagttctggcggcgcggtattt
gcggcgctcgagattgcgaggcagaatccgggttcggttgtggtcgcgattgtgtgtgat
aggggcgaccgttatctgtcatctgggttattttcttaa

DBGET integrated database retrieval system