KEGG   Shewanella sp. MR-4: Shewmr4_3011Help
Entry
Shewmr4_3011      CDS       T00388                                 

Definition
(GenBank) cysteine synthase B
  KO
K12339  cysteine synthase B [EC:2.5.1.47]
Organism
she  Shewanella sp. MR-4
Pathway
she00270  Cysteine and methionine metabolism
she00920  Sulfur metabolism
she01100  Metabolic pathways
she01110  Biosynthesis of secondary metabolites
she01120  Microbial metabolism in diverse environments
she01130  Biosynthesis of antibiotics
she01200  Carbon metabolism
she01230  Biosynthesis of amino acids
Module
she_M00021  Cysteine biosynthesis, serine => cysteine
Brite
KEGG Orthology (KO) [BR:she00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Shewmr4_3011
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Shewmr4_3011
Enzymes [BR:she01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.47  cysteine synthase
     Shewmr4_3011
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP DFP
Motif
Other DBs
NCBI-ProteinID: ABI40082
JGI: Shewmr43011
Position
complement(3596727..3597605)
Genome map
AA seq 292 aa AA seqDB search
MSDFPTIEACIGQTPLVRLQRLDCGSSTVLLKLEGNNPAGSVKDRAALNMIIQAELRQEI
APGDTLIEATSGNTGIALAMAAAIKGYKMILIMPSNSTQERKDAMLAYGAELLLVDNMEA
ARDLALELQAQGKGKVLDQFNNQDNANAHFQTTGPEIWQQSQGKITHFVSSMGTTGTIMG
VSKYLKSRNPDVTIVGLQPADGSSIPGIRRWPQEYLPGIFDAARVDAVMDIEEQDAKAMA
RTLAREEGICAGVSSGGAVFAALEIARQNPGSVVVAIVCDRGDRYLSSGLFS
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
gtgtctgactttccgactattgaagcctgtattgggcaaactccgctggtacgtttgcag
cgacttgattgtggtagctcaacggtattattaaagctggaggggaataaccccgcgggt
tcggtaaaggatcgcgcggcgctgaatatgattattcaggcggagcttcgccaagagatt
gcccctggggataccctgattgaagcgaccagtggcaataccggcatcgccttagccatg
gcggcggcgattaaaggctacaagatgatcctgatcatgccgtcgaattcgacccaagag
cgtaaggatgccatgctggcctatggcgccgagctgctgctggtggacaatatggaagcc
gcgcgggatttagccttagagcttcaggcacaaggcaaaggtaaggtgctggatcagttc
aataatcaagataacgccaacgcccatttccagaccactggccccgaaatttggcagcag
agccaaggtaagatcacccactttgtctccagcatgggcaccacaggcactattatgggc
gtgtcgaaatacctaaagagccgcaacccagatgtcaccattgtcgggctacaacccgcc
gatggcagttcgattccggggattcgtcgttggccgcaggaatatctaccgggtattttc
gatgctgcccgtgtcgatgcggtgatggatattgaggagcaagatgcgaaagccatggca
agaaccttggcccgtgaagaaggcatttgtgctggcgtgagttctggcggcgcggtattt
gcggcgctcgagattgcgaggcagaatccgggttcggttgtggtcgcgattgtgtgtgat
aggggcgaccgttatctgtcatctgggttattttcttaa

DBGET integrated database retrieval system