KEGG   Shewanella sp. MR-4: Shewmr4_3139Help
Entry
Shewmr4_3139      CDS       T00388                                 

Definition
ribosomal large subunit pseudouridine synthase A (EC:5.4.99.-)
Orthology
K06177  
tRNA pseudouridine32 synthase / 23S rRNA pseudouridine746 synthase [EC:5.4.99.28 5.4.99.29]
Organism
she  Shewanella sp. MR-4
Brite
Enzymes [BR:she01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.28  tRNA pseudouridine32 synthase
     Shewmr4_3139
    5.4.99.29  23S rRNA pseudouridine746 synthase
     Shewmr4_3139
Transfer RNA biogenesis [BR:she03016]
 Prokaryotic Type
  tRNA modification factors
   Psudouridine synthases
    Shewmr4_3139
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3759133..3759810
Genome map
AA seq 225 aa AA seqDB search
MTDFIYQPPTTPWLDVLYQDKDIIVVNKPSGLLSVPGRDPAHYDSVYARVKAEHPHCQIV
HRLDMATSGVMVVALIRSAERELKRQFHDRETSKTYLARVAGHIKNDTGSVDYPLICDWP
NRPKQKVDHEIGKPSLTHFEVLSRAKRSTLVKLKPITGRSHQLRVHMMALGHPILGDGFY
ADPLAKSLAPRLLLHAAELTIKHPYTGESMTFSADVPFCEPEGEQ
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgactgattttatttaccaaccaccgacaactccctggctcgatgtgctttaccaagat
aaagacattatcgtggtcaacaagccttcgggattattgtccgtgccaggtcgcgatccc
gcccattacgacagtgtttacgcccgagtaaaagccgagcatccccattgccaaatcgtc
catcgcctcgacatggcgacctcaggtgtcatggtggttgcgctcattcgtagcgccgag
cgcgagctaaaacgccaatttcacgatagagaaaccagcaaaacctatctcgctcgggtg
gctggtcatatcaaaaacgatactggcagtgtggattacccgctaatctgtgactggccc
aatcgcccaaaacagaaggttgaccacgaaattggtaaaccctcattaactcactttgag
gtgttaagccgcgccaaacgctcgactctcgttaagctaaagccgattactggacgctca
caccaactcagggtgcatatgatggcacttgggcatcctattctcggcgacggcttttat
gccgatccgctggcaaaatccttagcaccgcgattactactccacgcagcagaactgacc
ataaaacacccttatacgggtgagagcatgacgttcagtgccgatgtccccttttgtgag
ccagaaggtgagcaatga

DBGET integrated database retrieval system