KEGG   Shewanella sp. MR-4: Shewmr4_3172Help
Entry
Shewmr4_3172      CDS       T00388                                 

Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
she  Shewanella sp. MR-4
Pathway
she00900  Terpenoid backbone biosynthesis
she01100  Metabolic pathways
she01110  Biosynthesis of secondary metabolites
she01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:she00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Shewmr4_3172
Enzymes [BR:she01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Shewmr4_3172
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C SPOR
Motif
Other DBs
NCBI-ProteinID: ABI40242
JGI: Shewmr43172
UniProt: Q0HFC5
Position
3790755..3791609
Genome map
AA seq 284 aa AA seqDB search
MSNEISRNWPAPAKLNLFLHINGRRADGYHELQTLFQFIDCCDLLDFRVTQTPEQILHSD
MSAVVADSDNLILRAAKSLQQATGYPGGAEIWLEKRLPMGGGLGGGSSDAATTLVALNQL
WDTQLSNDELATIGLKLGADIPVFIRGFAAFAEGVGERLQAVTPTEFWYLVIAPDAHVST
AAVFQDPLLPRNTPKLGIDTLMSQPWANDCQDLVVSKYPQVAKALAWLLEYAPSRMTGTG
ACVFGEFSSQQQALAALAKLPSDMQGFVAKGMNISPLIVRLNRP
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaatgagatttcacgcaattggcccgcgcccgccaaattaaatctgtttctgcat
atcaacggacgccgcgccgacggttaccatgagttgcaaaccctgtttcagtttatcgat
tgttgcgatctgctcgattttcgggtgacacaaacacctgagcagatattgcactcggac
atgtcagccgttgtcgcggatagcgataacttaattctgcgagccgcaaaatcattacaa
caggcgacaggttatcctggcggtgccgaaatctggctcgaaaaacgtttacctatgggt
ggcggtttaggcggcggctcctcggatgctgccaccacgctcgtggcgttaaatcaattg
tgggatacccaattatctaacgatgaattggcgacgattggattaaaactcggtgccgat
atccctgtttttattcgcggtttcgcggcatttgccgaaggtgttggcgaacgtttacag
gcggtgacgcccactgagttttggtatttagtgatagcgcccgatgcccatgtttcaacc
gctgctgtgttccaagatcctttgctaccccgcaatacacctaagcttggcatcgacacg
ttaatgagccaaccttgggcaaatgattgccaagatctggtcgtttccaaataccctcaa
gttgccaaggccttagcctggctgctagaatatgcgccgtcgagaatgaccggaacgggc
gcatgcgtgtttggggagttttcttcgcagcagcaagctctcgcagccttggcgaaatta
ccgtctgatatgcaaggatttgttgcaaaagggatgaatatttcgccgctcatagtgcga
ctcaatcgtccataa

DBGET integrated database retrieval system