KEGG   Shewanella sp. MR-4: Shewmr4_3583Help
Entry
Shewmr4_3583      CDS       T00388                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
she  Shewanella sp. MR-4
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:she00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Shewmr4_3583
Enzymes [BR:she01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Shewmr4_3583
Exosome [BR:she04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Shewmr4_3583
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4286238..4287722)
Genome map
AA seq 494 aa AA seqDB search
MQKKYVVALDQGTTSSRAIVFDHDANIVSVSQREFTQLYPNPGWVEHDPMEIWASQSSVL
IESLARAGIHSDEVAAIGITNQRETTIIWEKATGKPVYNAIVWQCRRSSEICEQLKAQGL
EDYVRENTGLLLDPYFSGTKIKWILDNVPDARAKAKRGELLFGTVDTWLLWKLTEGKVHV
TDPTNAARTLLFNIHSLSWDTTLLEALDIPAAMLPEVRPSCSVYGTTRIAGEGSEIPLAG
IAGDQQAALFGQLCVEPGMAKNTYGTGCFLLMNTGNKAVRSSHGLLTTVAVGAQGEVNYA
LEGSVFMGGATIQWLRDELGLIRDASDTEYFASKVADTNGVYLVPAFVGLGAPYWDPNAR
GALFGLTRGANRNHIIRAALESIAYQSKDLLDAMIKDSGERLKSLKVDGGAVANDFLMQF
QADITDVEVLRPSVCETTALGAAFLAGLAVGFWTSVTELEYKACIDKHFKPNIDASQRER
LYVGWQDAVVRTRS
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
gtgcagaaaaaatatgtagtggctttagaccaaggcacaaccagctcaagggcgattgtg
tttgaccacgatgccaatattgtcagtgtgtcacagcgagagtttacccagctttatcca
aatcccggctgggtggagcatgatccaatggagatctgggcgagccaaagttcggtgtta
atcgaatccctcgccagagcgggtattcacagcgatgaagtggcggccattggtatcact
aatcagcgcgaaaccaccattatctgggaaaaggccacaggtaaacccgtctacaatgcc
attgtgtggcagtgtcgccgcagctcagaaatctgtgagcaactcaaggcccaaggctta
gaagattatgtgcgggagaatacggggctcctgctcgacccttatttttcaggcactaag
atcaaatggatcctcgataatgtgccggatgcgcgcgcgaaggccaaacgaggtgaactc
ttattcggcacggtcgatacttggttgctatggaaactcaccgaaggcaaagtgcatgtg
accgatcccaccaatgccgcccgcacgttgctgtttaatatccacagcctaagttgggac
acaacactgctcgaggcgctcgatattcctgcggctatgttgcccgaagtgagaccttcc
tgcagtgtctatggcacaacccgtattgccggtgagggcagcgaaattcctctcgcgggg
atcgcgggcgatcaacaggcggcgctctttggccagctttgtgttgagcctggaatggcc
aaaaacacttatggcacaggctgctttttattaatgaatacaggcaacaaagccgtacgt
tcatcccatggattattaaccacagtagcggtaggcgcccaaggtgaagtgaactacgcc
cttgaaggctcagtatttatgggcggcgcgacgattcaatggctgcgggatgagctgggg
ttgatccgcgatgccagcgacaccgaatattttgcctctaaagtcgcggatacaaatggc
gtgtatttagtgccagcttttgtcgggcttggcgctccctattgggatcctaatgcccgt
ggcgcgctgtttgggttaacgcgcggtgctaaccgtaatcatattatccgcgcggcattg
gagtcgattgcctaccagagtaaggatttgctcgatgccatgattaaggacagcggtgag
cggctaaaatcccttaaggtggatggtggcgcggttgctaatgacttcctcatgcaattt
caagcggatatcaccgacgttgaagtcttaaggccaagcgtgtgtgagaccaccgcgctt
ggcgcagcctttttagcaggtcttgcggtcggcttttggacctcagtgaccgaacttgag
tataaagcctgtatcgacaaacacttcaaacccaatattgatgcgagtcaaagggagcga
ttatatgtgggctggcaggatgctgtagtaagaactcgctcttag

DBGET integrated database retrieval system