KEGG   Shewanella sp. MR-4: Shewmr4_3583Help
Entry
Shewmr4_3583      CDS       T00388                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
she  Shewanella sp. MR-4
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:she00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4286238..4287722)
Genome map
AA seq 494 aa AA seqDB search
MQKKYVVALDQGTTSSRAIVFDHDANIVSVSQREFTQLYPNPGWVEHDPMEIWASQSSVL
IESLARAGIHSDEVAAIGITNQRETTIIWEKATGKPVYNAIVWQCRRSSEICEQLKAQGL
EDYVRENTGLLLDPYFSGTKIKWILDNVPDARAKAKRGELLFGTVDTWLLWKLTEGKVHV
TDPTNAARTLLFNIHSLSWDTTLLEALDIPAAMLPEVRPSCSVYGTTRIAGEGSEIPLAG
IAGDQQAALFGQLCVEPGMAKNTYGTGCFLLMNTGNKAVRSSHGLLTTVAVGAQGEVNYA
LEGSVFMGGATIQWLRDELGLIRDASDTEYFASKVADTNGVYLVPAFVGLGAPYWDPNAR
GALFGLTRGANRNHIIRAALESIAYQSKDLLDAMIKDSGERLKSLKVDGGAVANDFLMQF
QADITDVEVLRPSVCETTALGAAFLAGLAVGFWTSVTELEYKACIDKHFKPNIDASQRER
LYVGWQDAVVRTRS
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
gtgcagaaaaaatatgtagtggctttagaccaaggcacaaccagctcaagggcgattgtg
tttgaccacgatgccaatattgtcagtgtgtcacagcgagagtttacccagctttatcca
aatcccggctgggtggagcatgatccaatggagatctgggcgagccaaagttcggtgtta
atcgaatccctcgccagagcgggtattcacagcgatgaagtggcggccattggtatcact
aatcagcgcgaaaccaccattatctgggaaaaggccacaggtaaacccgtctacaatgcc
attgtgtggcagtgtcgccgcagctcagaaatctgtgagcaactcaaggcccaaggctta
gaagattatgtgcgggagaatacggggctcctgctcgacccttatttttcaggcactaag
atcaaatggatcctcgataatgtgccggatgcgcgcgcgaaggccaaacgaggtgaactc
ttattcggcacggtcgatacttggttgctatggaaactcaccgaaggcaaagtgcatgtg
accgatcccaccaatgccgcccgcacgttgctgtttaatatccacagcctaagttgggac
acaacactgctcgaggcgctcgatattcctgcggctatgttgcccgaagtgagaccttcc
tgcagtgtctatggcacaacccgtattgccggtgagggcagcgaaattcctctcgcgggg
atcgcgggcgatcaacaggcggcgctctttggccagctttgtgttgagcctggaatggcc
aaaaacacttatggcacaggctgctttttattaatgaatacaggcaacaaagccgtacgt
tcatcccatggattattaaccacagtagcggtaggcgcccaaggtgaagtgaactacgcc
cttgaaggctcagtatttatgggcggcgcgacgattcaatggctgcgggatgagctgggg
ttgatccgcgatgccagcgacaccgaatattttgcctctaaagtcgcggatacaaatggc
gtgtatttagtgccagcttttgtcgggcttggcgctccctattgggatcctaatgcccgt
ggcgcgctgtttgggttaacgcgcggtgctaaccgtaatcatattatccgcgcggcattg
gagtcgattgcctaccagagtaaggatttgctcgatgccatgattaaggacagcggtgag
cggctaaaatcccttaaggtggatggtggcgcggttgctaatgacttcctcatgcaattt
caagcggatatcaccgacgttgaagtcttaaggccaagcgtgtgtgagaccaccgcgctt
ggcgcagcctttttagcaggtcttgcggtcggcttttggacctcagtgaccgaacttgag
tataaagcctgtatcgacaaacacttcaaacccaatattgatgcgagtcaaagggagcga
ttatatgtgggctggcaggatgctgtagtaagaactcgctcttag

DBGET integrated database retrieval system