KEGG   Shewanella sp. MR-4: Shewmr4_3613Help
Entry
Shewmr4_3613      CDS       T00388                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
she  Shewanella sp. MR-4
Pathway
she00230  Purine metabolism
she01100  Metabolic pathways
Module
she_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:she00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Shewmr4_3613
Enzymes [BR:she01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Shewmr4_3613
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_16 MMR_HSR1 RsgA_GTPase AAA_33 AAA_22 Peptidase_M28 AAA_29 ABC_tran cobW
Motif
Other DBs
NCBI-ProteinID: ABI40677
JGI: Shewmr43613
UniProt: Q0HE40
Position
4320450..4321073
Genome map
AA seq 207 aa AA seqDB search
MTARGNLFIVSAPSGAGKSSLISALLKDKPADMQVSVSHTTRAPRPGEVNGQHYHFVNVE
EFKALIEQNAFFEWAEVFGNYYGTSRHVIEHTLTQGIDVFLDIDWQGAQQVKAVMPEAIG
VFILPPSRDELERRLTGRGQDSQEVIASRMAQAVSEMSHYKEYDFIIVNDDFDTALADMR
AIIRSQRLTGASQIHAQNDMLNDLLAG
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcacgcggaaatttatttattgtttcagccccgagtggtgctggtaaatcctcg
ctgatttcggcgctgctgaaagacaaacccgccgacatgcaggtttcagtgtcgcacact
acccgtgcgcctcgccctggcgaagtgaatggtcaacactaccattttgttaatgttgaa
gaatttaaagcgctgatcgagcaaaatgcctttttcgagtgggccgaagtattcggtaac
tactatggcacttcgcgccacgtcattgagcacactttgactcaaggtatcgatgttttc
ctcgatatcgactggcaaggcgctcagcaagtcaaagccgtgatgccagaggccattggt
gtatttattctaccgccctcaagggatgagctagaacgtcgcctcactggccgtggccaa
gacagtcaagaagttatcgccagccgtatggcacaggcggtttctgaaatgtcgcactat
aaagaatatgattttattatcgtcaatgacgattttgacacagcactggccgatatgcgg
gcgatcattcgcagccaacgcttaacgggtgctagtcagatccacgcgcaaaatgatatg
cttaacgatctgttggcaggctaa

DBGET integrated database retrieval system