KEGG   Shewanella sp. MR-4: Shewmr4_3852Help
Entry
Shewmr4_3852      CDS       T00388                                 

Definition
malate synthase (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
she  Shewanella sp. MR-4
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:she00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Shewmr4_3852
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Shewmr4_3852
   00630 Glyoxylate and dicarboxylate metabolism
    Shewmr4_3852
Enzymes [BR:she01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Shewmr4_3852
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4600418..4600981
Genome map
AA seq 187 aa AA seqDB search
MNMSIINSHQIQPNLNSFIAEEVLAVAQVNVAEHEKLAQAKQFLDRHFPLDAGSHQDVIS
YVVYYQHLLAFFADGSHSGLRQTKQFVAFNGTKDAPSAIVLQDQGCHVELCFDRTGMIGA
RDLANLEDVQIEAPVELAAEPTETRNTTSRHWLSLLHAGMPSANDIQDKLFTAKDGGDYS
LQRIVNL
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgaatatgtcaattatcaatagccaccagatccaaccgaatctaaacagcttcatcgca
gaagaagtgcttgccgtcgcccaagtgaacgtggccgagcatgaaaaactagcccaggcg
aagcagttcctcgaccgtcatttcccactggatgcgggttcgcaccaggatgtgatcagc
tatgtggtttactaccaacacctgctggcattttttgccgacggcagccacagcggatta
cgccaaaccaagcagtttgttgccttcaacggcactaaagatgcgccaagcgccatagtg
ttacaggaccaaggctgccatgtagagttgtgtttcgaccgcactggcatgataggcgcg
cgggatttagcgaatttggaagatgtgcaaatcgaagcgcccgttgagttagccgccgaa
cccacagagacacgtaataccacctcgcgccactggttaagcctgttacatgcaggaatg
ccaagcgctaacgatattcaagacaagctgtttaccgctaaagatggtggcgactacagc
ctgcaacgtatcgtgaatctctaa

DBGET integrated database retrieval system