KEGG   Shewanella sp. MR-4: Shewmr4_3914Help
Entry
Shewmr4_3914      CDS       T00388                                 

Definition
alpha/beta hydrolase fold domain-containing protein
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
she  Shewanella sp. MR-4
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:she00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Shewmr4_3914
Enzymes [BR:she01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Shewmr4_3914
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4668347..4669360
Genome map
AA seq 337 aa AA seqDB search
MSQTPLNFPREEFSKVAFSTEHDLNTSEQQAFWQTVVQDTLKTPDGLTLAYMMVKHPKAH
ASIVISSGRVESYLKYQELVFDLYQQGYSVFAIDHRGQGLSSRMTANPHQGHVRRFNDYI
DDFALFMQTVVLKHATSPLFLLGHSMGGAIGTLYLKQHPDVFTAAAFSAPMYGIKLPMPK
GFVRWLASKLDASLNGGEPNYVLSGQNYKAAPFKGNDLTHCQSRYQAYRELYDAAPKLQL
GSPTNRWLTESLDAADACVLATAHIRTPILILQASEDKIVDNAAQNLAVSSNCQLKVIAG
AAHEIFMEKDSYRNQALNYALDFFKRYATRDVDKQAV
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgagccaaacgcccctaaactttccaagggaagagttttccaaggtagctttttcaacg
gaacacgatttaaatacttctgaacagcaagccttctggcaaaccgttgtccaagacaca
ctcaaaacgcccgatggattaaccttggcctacatgatggtcaaacaccccaaggcccat
gccagcatagtcatcagcagtggccgggttgagtcctacttaaagtatcaagaactcgtt
tttgatttgtaccagcaaggctattcggtatttgctatcgatcaccgcggccagggatta
tcaagtcgcatgacggccaatccccatcaaggccacgtgagacggttcaacgactatatc
gacgactttgccctgtttatgcaaaccgttgtactcaaacatgccacttcgccactgttc
ttgctcgggcattccatgggcggcgccatcggtaccttgtatctcaaacaacatccggat
gtgtttacggcggcggcattctccgcccccatgtacggcattaagttacctatgccgaaa
gggtttgttcgttggcttgcgagtaagctcgatgccagtctcaacggcggggaacctaac
tatgtcctcagcgggcaaaactataaggccgctccttttaagggcaatgatctcacccat
tgccagagtcgttatcaagcctaccgagagttgtacgatgcggcgccaaagctgcaatta
ggctcacccactaaccgctggttgactgaatctttagatgcggccgatgcctgtgtattg
gccacagcacatatccgcacgcctattctgatcctgcaagccagtgaggataagatcgtc
gacaatgccgcacaaaatctggcggtaagctcaaattgccaattaaaggtgattgcaggg
gctgcccatgagatttttatggagaaagatagctaccgtaatcaagcgcttaattacgcg
ctcgacttttttaaacgctacgcaacaagggacgtggacaaacaagctgtttaa

DBGET integrated database retrieval system