KEGG   Sphingobacterium sp. 21: Sph21_0060Help
Entry
Sph21_0060        CDS       T01450                                 

Definition
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
shg  Sphingobacterium sp. 21
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:shg00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Sph21_0060
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Sph21_0060
Enzymes [BR:shg01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     Sph21_0060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(66010..67473)
Genome map
AA seq 487 aa AA seqDB search
MISLSKILNGVSIKQLIGSMDVTVHAVRFDSRQVVDGDLFVAVRGTLTDGHVFIDKAVAL
GAKIVVCEQLPQDLSGHITYIQVENAGFALGLIAANFYDNPSAKLKLVGVTGTNGKTTVA
TLLYKLFVELGFRVGLISTVQNKVNERVIESTHTTPDPISLNELLCEMVNSGCDYCFMEV
SSHAVAQHRITGLSFVGGVFTNLTHDHLDFHKTFDAYLKAKKAFFDMLPKSAFALVNIDD
KNGSVMLQNTDAYKKTYGLKNIADFKGRIVESHFNGMLMQIDTREVWIRLVGAFNAYNLL
AVYSVAILLEQDTTRVLTILSRLTGAEGRFDTLVSGNGVIGIVDYAHTPDAVENVLRTIV
DLRKNKEQIIAVLGCGGDRDKTKRPEMAAVAANLSDKVILTSDNPRSEDPQQIIREMEAG
IPADKKRHVFSITDRYEAIKAAVHLAQPGDIVLIAGKGHEKYQEVMGEKRPFDDKAILKD
LFKEVND
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgatttcgctatcgaaaatattgaatggtgtatctataaaacagcttataggtagcatg
gatgtgactgttcatgcggtacgttttgattcccgccaagtggtagatggtgatcttttc
gttgctgtcaggggaactcttaccgatggtcatgtatttatagataaagcagttgccctg
ggagctaagatagtggtatgcgagcagctacctcaagaccttagtgggcacattacctat
atacaagttgagaatgcaggctttgcactagggttgatagctgctaacttttatgataac
ccatccgccaaattgaagttagtgggcgtaaccggcacgaacggaaaaacgacggttgcg
acgttactatataaattatttgttgaactcggatttagagttggccttatttcgactgta
caaaataaggtgaacgagcgcgtcattgaatcaacccataccacacctgatccgataagc
ttaaatgagcttttatgtgagatggtaaacagtggttgtgattattgcttcatggaggtt
agctcgcatgcggttgcacagcatcgaattacaggtttgtcctttgttggtggtgttttt
accaacttaacgcatgaccatttggattttcacaaaacttttgatgcctatctaaaagcg
aaaaaggcttttttcgatatgctgcctaagtcggcttttgccttggtgaatatagatgat
aaaaatggaagcgtcatgctccagaataccgacgcttacaaaaagacatacggtttaaag
aatattgccgactttaaagggaggattgtggaaagccatttcaatggtatgctaatgcaa
atcgatacacgtgaagtatggatacgtttagttggtgcgttcaatgcttataatttgttg
gcagtgtatagtgttgccattcttttggaacaggatacgacccgagtgttaacgatttta
agcagattaaccggagcagaaggtagattcgatacgctggtttcgggtaacggtgttatt
ggtatcgtggattatgcgcatacgcctgacgcggtggaaaatgtcttgcgaacgattgta
gatttgcgaaaaaataaggaacaaataatagctgtattaggctgcggcggagatagggat
aagacaaagcgacccgaaatggcggcggtagccgcaaacttaagtgataaggtgatttta
acctcagataacccaagaagcgaagatccgcaacagattattcgcgaaatggaagctggg
atacctgccgataagaaaagacatgtgttttccatcacggatcgctatgaagccatcaaa
gcagctgttcatcttgcacaaccgggtgacattgttctcatagcgggcaagggacatgaa
aaatatcaggaagttatgggggaaaaaagaccttttgacgataaagcaatattaaaggat
ctttttaaagaggtaaacgactaa

DBGET integrated database retrieval system