KEGG   Sphingobacterium sp. 21: Sph21_0320Help
Entry
Sph21_0320        CDS       T01450                                 

Definition
(GenBank) Protein-L-isoaspartate O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
shg  Sphingobacterium sp. 21
Brite
Enzymes [BR:shg01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Sph21_0320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT RrnaAD Orbi_NS1 Methyltransf_25 Methyltransf_31 DUF2795 CMAS Methyltransf_23
Motif
Other DBs
NCBI-ProteinID: ADZ76902
UniProt: F4C350
Position
complement(349955..350611)
Genome map
AA seq 218 aa AA seqDB search
MAYKFVDNYREKGARKQLVETLRKRGIADEAVLSAVGKVPRHFFFDETFWTQAYKDIAFP
IGDGQTISQPYTVAYQTELLHIRRGDKVLEIGTGSGYQTCILLELGAEVFTIERQTNLYN
RTIKVLPYMGYQAHFFLGDGSKGLPQHAPYHKIIVTAGAPFVPEIMLKQLAIGGILVIPV
GDAKTQKMVTVIRTGEQDFEKIELDTFRFVPLVGDQAW
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atggcttataaatttgtagacaactatcgggaaaaaggtgccagaaagcaactggttgaa
acattaagaaaaagaggtattgctgatgaggcagtattgagcgctgttggaaaggtgcca
cgccactttttttttgatgagaccttttggacacaagcgtacaaagacatcgcttttcct
ataggcgacggacagacaatctctcaaccttacacggtagcctatcaaacggagctgttg
catattaggagaggggataaggtgcttgaaattggaacgggttcaggttaccaaacatgt
attttactcgaacttggagccgaagtttttaccattgaacggcaaactaatctttataat
aggactattaaagtgcttccctacatgggataccaagcccacttttttttaggagatggt
tcaaaaggattgcctcaacatgctccctatcacaaaattattgtaacagcaggtgcaccc
tttgtgcccgaaatcatgttaaaacaattggcgattggaggtatattggttattccggta
ggtgatgcaaagacgcaaaaaatggtgacggttattcgtacaggtgaacaagattttgag
aagatcgaacttgatacctttcgattcgttccgcttgttggcgatcaggcctggtag

DBGET integrated database retrieval system