KEGG   Sphingobacterium sp. 21: Sph21_0595Help
Entry
Sph21_0595        CDS       T01450                                 

Definition
aldose 1-epimerase
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
shg  Sphingobacterium sp. 21
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:shg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sph21_0595
   00052 Galactose metabolism
    Sph21_0595
Enzymes [BR:shg01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Sph21_0595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(735499..736641)
Genome map
AA seq 380 aa AA seqDB search
MKIKYYVYYILGCIALSCNNPARENNANERSVKETTAFDSQIDGKEAKLYTISNGKGLTA
TLTNYGGRVVSLTVPDKDGKPVDVVLGFATAAEYKAASEPYYGATIGRVGNRIAKGKFEL
DGKEYSIFTNNGQNTLHGGKKGFQDVVWDAEQASDSSLVLRYRSPDGEENFPGNLEVKIT
YTATANNGLRFDYEATTDKRTPVNLTNHAFFNLNGEGSGTINNHLLQIKADRYTPVDSTL
IPLGNLASVKNTPFDFTTAQAIGSRVDQDNEQLKFGGGYDHNFVLNKGNKYGLAATVTGD
KSGIVMQIFTDEPGLQFYGGNFMKGQNTLKSGVKDDYRTSFALETQHFPDAVNQPDFPSI
ILDPGKVYKTTSEYVFSVTK
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgaagataaaatactatgtttattacatattgggctgtatagccctttcgtgtaataac
cccgcaagagaaaacaacgcaaatgagcgcagcgtaaaagaaacaacagcgtttgatagc
caaatcgatggtaaagaagcgaagctttatacaatcagcaatggaaagggattaaccgca
acactcacgaattatggtggcagagttgtcagtttaaccgtaccggataaagatggtaag
cctgttgacgtcgttttaggttttgcgacagcggcggaatacaaggccgcttcagagcca
tattatggtgcgacgatcggccgtgtagggaatcggatagcgaaagggaaatttgaattg
gatggaaaagaatatagtatctttaccaataatgggcaaaacaccttgcatggcggaaaa
aaaggatttcaggacgtagtgtgggatgcagaacaagcaagcgactcttcacttgttttg
cgataccgttcacccgatggtgaggaaaattttccaggaaacttagaagttaaaataacc
tataccgccactgccaataatggattgcggtttgattacgaggcaactactgataaacgc
acgcctgttaatcttacaaaccatgctttctttaatctgaacggggaaggctcgggcacc
attaataatcatcttctacaaataaaggcagatagatatacaccggttgacagcaccctg
attccgctgggtaatttagcttctgtcaagaatacgccctttgacttcacaacagcgcaa
gccattggtagccgcgtagatcaggacaatgagcaattaaaattcggaggtgggtacgat
cataattttgtactcaacaaagggaataagtatggtttagcagctactgttacgggtgat
aagagtggcattgttatgcagatctttaccgacgaaccgggattgcagttttatggaggc
aattttatgaagggacaaaataccctgaaaagcggcgtgaaggatgactatcgaacatct
tttgctttagagactcagcattttccggatgccgtaaatcaaccggactttccgtcgatc
attctggacccgggcaaggtctacaaaacgacttcggagtacgtcttttccgttactaaa
tag

DBGET integrated database retrieval system