KEGG   Sphingobacterium sp. 21: Sph21_0612Help
Entry
Sph21_0612        CDS       T01450                                 

Definition
L-fucose isomerase
Orthology
K01818  
L-fucose isomerase [EC:5.3.1.25]
Organism
shg  Sphingobacterium sp. 21
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:shg00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Sph21_0612
Enzymes [BR:shg01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.25  L-fucose isomerase
     Sph21_0612
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(761950..763713)
Genome map
AA seq 587 aa AA seqDB search
MNNYPKIGIRPIIDGRLGGIRESLEETTMNMAQDVAALFQSELRYPDGSPVQCVIADTCI
GGVREAADCAQKFEAENVGVSLSVTPCWCYGSETMDMNPLLPKAIWGFNGTERPGAVYLA
ATLAAHNQKGLPAFGIYGEDVQDMGDRFIPDDVKEKLLSFARAGLAVAIMRGKSYLAIGS
VSMGIVGSIVDADFFQNYLGMRNEYVDSSEVLRRIQLNLFDQDEYERALAWTKKYCKEGE
DFNQSHKVKSRAEKDNDWEFVVKMTLIIRDLMIGNKKLKDMGYAEEAHGHHALVSGFQGQ
RQWTDFLPNGDFSEALLNSSFDWNGKRAPFIVATENDSLNGVSMLFNYLLTNKAQIFADV
RTFWSPDAVERVSGWRPTGVAQHGFIHLINSGAATLDGTGKQKYEGEPVMKPHWEISDEE
VEACLAATTWHPANLDYFRGGGYSSKFLTEGGMPVTMCRLNLVKGVGPVLQLAEGWTLEL
PENVNKLLDERTDRTWPTTWFVPKTTGEGAFRDVYSVMAAWGSNHGAISHGHIGADLLTL
AAMLRIPVCMHNVESPRIFRPSAWNAFGMDHEGADYRACASYGPLYK
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
atgaacaactatcccaaaataggaattaggcccattatcgacgggcgcttaggaggtatc
cgcgaatcattggaagaaacgactatgaatatggcgcaggatgtggctgctttatttcag
tcagagttgcgttaccctgacggaagtccggtgcaatgtgtgattgccgatacttgcatc
ggcggcgtaagggaggccgccgattgtgcacaaaagttcgaagccgaaaatgtcggtgtt
tctttgtctgtaacaccttgctggtgttatggttcagaaacaatggatatgaatcccttg
ttgccgaaagcaatttggggtttcaatgggacagaacgccctggtgcggtgtatttggca
gctacccttgcggcccacaaccaaaagggacttccagcttttggtatctatggcgaggat
gtacaagatatgggagatcgctttattccggatgatgtaaaagaaaaactgttgagcttt
gcacgcgcgggtttagcagtagccatcatgcgcggaaaatcgtatttagccattggttcg
gtttctatgggcatagtgggatcaatcgttgatgctgacttttttcagaattatttaggc
atgcgtaatgaatacgttgattcgtcagaagtgctacgcagaattcaactgaatttgttt
gatcaggatgaatatgaacgggcgctagcttggacaaaaaaatactgtaaagaaggtgag
gattttaatcaatctcataaagtaaaatcgcgcgccgaaaaagataacgattgggaattt
gtagtgaaaatgacccttattatccgcgacctcatgatcgggaacaaaaagttaaaggat
atggggtatgctgaagaggcacacgggcatcatgccttggtatcgggcttccaagggcaa
cgccaatggaccgatttcctgccgaacggcgatttttcagaagcattgctgaattcttcc
ttcgattggaatggcaaacgtgccccctttatagtagctaccgaaaacgattcgttgaac
ggggtgtccatgctgtttaattacttattgacaaataaagcgcagatttttgccgatgtc
cgaaccttttggagcccggatgcggttgagcgtgtttcgggttggcggcctacaggtgtt
gctcaacatggctttatccatttaattaactccggagccgctacgctggatggcaccggt
aaacagaaatacgaaggagagcctgtgatgaaaccacattgggaaattagcgatgaagaa
gtggaagcttgcttagcagcgaccacttggcatccggcaaatctcgattattttagagga
ggcggctattcgtccaaatttttgacagagggcggtatgccggttacgatgtgtcgttta
aatctggtgaaaggcgtaggacctgtattacaactggctgagggatggacgctagaactg
ccggaaaacgtaaataagctactggatgaacgaacagatcgcacatggccaactacttgg
tttgtaccgaaaaccacaggagaaggcgcgtttcgtgacgtttatagtgtaatggctgct
tggggctccaaccacggcgctattagtcatggacatatcggtgctgatctattaacgttg
gcagccatgcttcggatccctgtttgtatgcataacgttgaatcccctcgcatttttaga
cccagcgcctggaatgcctttggtatggaccatgaaggtgctgattaccgcgcctgtgcc
agttatggaccactatataaataa

DBGET integrated database retrieval system