KEGG   Sphingobacterium sp. 21: Sph21_0968Help
Entry
Sph21_0968        CDS       T01450                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
shg  Sphingobacterium sp. 21
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:shg00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Sph21_0968
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Sph21_0968
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Sph21_0968
Enzymes [BR:shg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Sph21_0968
Exosome [BR:shg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Sph21_0968
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1176670..1178499)
Genome map
AA seq 609 aa AA seqDB search
MNIRKWICACSLASSGLFAHAQQYTVNKNAHSHNDYLQAQPFYTAYANRFASIEIDVFLK
NDSLYVAHEEEEIKPGHTIQNLYLKPLLQQISLHNGKVYPEGGQLQFLIDLKTDGEPTLK
ALERQLTPIRAYFDVNRNPDAVRLVISGDMPKPERFGAFDPIFYFDGRTQLRYSDEQLKR
VAFYSAPFQSFSVWNGLGRITEPERNKVKHFIDSVHAVGKPVRFWGCPDTKTAWQAFIKL
GVDYLNTDSPNILASFLNRYEVNSYTRKNKHEIYRPSYKQDGTKGKVKRVILLISDGAGF
NQQWAAATINGGQLNMTQFKHIGFQNTAPADDYNTDSAAGATAFATGEKTKNRYIGNDST
GKALPNLPEKLNNIQIPSAILTNDRLTGATPASFFAHQSERDHSTAIAYDILKSPVKLFV
GGSHPSLVADSAKLKQQLVAKGTVICTDPHELDTVSGEQLICLAQDDPSRGYHMLEDAFD
DALALMEKRHDRFFMMVEGAKIDGGGHSNKIAQCIEEYLSFDRILGKALQYADKNEGTLV
VVTSDHETGGLVLVDGDYEKGFVLGEFVTNDHTGAPIPVYSYGPGAARFTGFMQNSDIGK
RIFELLSAK
NT seq 1830 nt NT seq  +upstreamnt  +downstreamnt
atgaatataagaaaatggatatgtgcgtgcagcttggcaagtagcgggctgtttgcgcac
gcacagcagtacacggttaacaaaaacgcgcattcgcacaacgattatttacaagcacag
cctttttatacagcttatgcgaatcgttttgcttccatcgaaatagacgtgtttctgaaa
aatgattcactttatgtagcacacgaagaggaggagattaaacccggacacaccattcag
aatctctatctaaagcccttattgcaacagatatctttgcataatggtaaggtataccct
gaaggtgggcaactacaatttttgatcgacttaaaaacagatggagagcctaccttgaaa
gcattggagcgccaacttacccccattcgggcttattttgatgtaaaccgaaatccggat
gccgtgcgtttagtaattagtggtgatatgcctaagccggagcgtttcggggcctttgat
ccaatattttactttgacggccgtacacagcttcgctatagcgatgaacagcttaaacga
gtcgcattctatagtgcaccttttcagtctttcagtgtttggaacggtttgggaagaata
actgagccggagcggaacaaagtaaagcattttatcgattcggtgcatgcagttggtaaa
cccgtacgcttctggggctgtcccgacaccaaaacggcctggcaggcctttataaaattg
ggagtagattacctaaataccgattcaccgaatattctggctagctttttaaatagatac
gaggtgaatagttatacccgtaaaaataagcatgaaatatatcggccaagctataagcag
gatggtacgaaaggaaaggtgaagcgggtcattttgcttatcagcgacggagcaggtttc
aaccagcaatgggcagcagcgaccatcaatggtggccaattgaatatgacacagtttaag
catattggttttcagaacactgcaccggcggatgattacaacactgattccgcagcaggt
gcgacagcttttgctacgggtgaaaaaacaaaaaatcgatacatcggtaacgatagtacc
ggcaaagctttgcccaatttaccggagaagttgaataacatacagataccaagtgctatt
ctcacaaacgatcgacttaccggcgcaacacccgcctctttctttgcacatcaaagcgag
cgcgaccattcgacagccatcgcttatgatattcttaaaagccctgtaaagttatttgta
ggcggcagccacccaagcttagtcgcagatagcgctaaactgaaacaacagttagtggca
aaaggtaccgttatttgtaccgacccacatgagctggataccgtttccggcgagcagctt
atttgtctggcccaagatgatccttccaggggctatcatatgttggaagatgcatttgac
gatgccttggctctaatggaaaagcggcatgatcgtttttttatgatggttgaaggcgct
aaaattgacgggggtggacacagcaataagattgcacaatgtattgaggaatatctaagc
tttgataggatattgggaaaggccttgcaatatgccgataaaaatgagggaacactggta
gtggtgacctctgatcatgaaacaggcggattagtattggtggatggtgactatgagaag
ggcttcgtactcggtgagttcgttacaaatgaccataccggtgcccctattcctgtatac
agttatggccccggagccgctaggtttactggttttatgcaaaacagcgatatcgggaag
cgcatttttgaactactctccgctaaataa

DBGET integrated database retrieval system