KEGG   Sphingobacterium sp. 21: Sph21_1083Help
Entry
Sph21_1083        CDS       T01450                                 

Definition
beta-N-acetylhexosaminidase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
shg  Sphingobacterium sp. 21
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:shg00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Sph21_1083
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Sph21_1083
Enzymes [BR:shg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Sph21_1083
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1333661..1335925)
Genome map
AA seq 754 aa AA seqDB search
MEKKKFSTGLSLWVFLCLCPTILFAQDSLSIIPAPTFLQEKPGYFQYPELAEVYVSQDFT
EEVELLRTHPYIHFETPHKLKSRKKMPESGIFLLKAEAEDRLPQRAYQLEVDTGKITIIA
HDRQGVIHALATLTQIAYTQSNERLLPAVSIQDEPAFAYRGLMLDVSRHFYPISFLKRMI
DLMALYKLNTFHWHLTDGAGWRLEIKRYPQLTQKAAWRNYPRWKDWWNSGRRYLEVGDPN
ASGGYYTQEEARDFVAYAAEKGITVIPEIEMPGHSEEVLATFPQLSCSGEAYRNAEFCIG
NEETFSFITNVLDEVMDIFPSTYIHIGGDEADKKAWKNCPKCQERIKSDNLQNEEGLQSY
AIKRVEAYLKDKGRKLIGWDEILEGGLPPEATVMSWRGEQGGIEAANAGHDVIMTPGAYL
YFDSYQSNPIGQPEAMGGFLPLEKVYSYHPIPAEIAADQQKHILGVQANVWTEYMPTQEQ
VEYMVFPRAIALAEIGWTPADKRVWQDFKKRLQKHYLLLQRLHVNYYRPSYDVSIASKYD
INKKKATVTISSEQYSPEIRYTTDGSEPTTASTLYIDSLSLVNTTTIKAAVFKDSVRFGK
VEDFTVDIHKGIGKKIVYNNQWNDKYPAKLDSSLLNGQYGGLSYGDGEWQGFLGDFDVTL
DFERREELHEIKLRFMQLAGPGVYIPGSVKILASDDGKHFREMEKIDNDVPTTDPSLRFK
TFSFDLEGRLARYIRIVGQNNMKGFLFTDEIVVY
NT seq 2265 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagaagaagttctctaccgggctatctctatgggtttttctttgcctttgccca
acgatactctttgctcaagatagcctttctattataccagcaccaacatttttacaagaa
aagcccggatactttcaatacccggaattagcggaggtctacgtaagtcaagattttaca
gaagaagttgaattgctccgaacccatccctatatccattttgaaacgcctcataagctg
aaatccaggaaaaagatgcccgaaagcggtatttttttgcttaaagccgaagccgaggat
cgcctgccccaacgcgcttatcaattggaggtagacacaggaaagataacgatcatagcc
catgatcgtcaaggggtaatacacgctttagcgacactcacccaaattgcttatacgcaa
tcaaacgaacgcttgctaccggctgtttccatacaagacgaacctgcttttgcttatcgg
ggattaatgcttgacgtgtctcgacatttttacccgatttcttttttgaagcgaatgatt
gatctgatggccctatataagttaaacacctttcattggcatttaacggatggggcggga
tggcgtctggaaataaaaagatatcctcaactgacgcaaaaggcggcgtggagaaattat
cctcgttggaaggattggtggaattcaggacgaagatacttggaagtgggagatcctaat
gcttccggtgggtactacacgcaagaggaagcgcgtgattttgtagcctatgcagctgaa
aagggcattaccgtaattcccgaaattgagatgcccgggcatagtgaagaggttttggca
acttttccgcagctctcctgctcaggtgaggcttatagaaatgcggagttttgtatcggc
aatgaggagaccttttcttttattactaatgtgttagatgaagtgatggatatatttcct
tctacgtatatccatattgggggagatgaagcagacaagaaagcttggaaaaactgtccc
aaatgccaagaacgaataaagagcgataatcttcaaaatgaagaaggcctgcagagttat
gcgatcaagcgggttgaggcgtatttgaaagacaaggggagaaaactcattggatgggac
gaaatattggaggggggcttgcccccggaagcgactgtcatgagctggcggggagagcaa
ggtgggattgaggcggcaaacgcggggcacgatgtgattatgacgcctggcgcttatcta
tatttcgactcttaccaaagtaatccaattggtcagccggaggccatgggtggtttctta
cctttagagaaggtgtattcttatcatcccattccggctgaaattgcggctgatcaacaa
aaacatattttaggggtacaggcaaatgtctggacagaatacatgccaacgcaggagcaa
gttgaatatatggtttttccaagagctatagcgttggcagaaattggatggacacctgct
gataaacgggtttggcaagactttaaaaagcgtttgcaaaaacattatttgcttttgcaa
cgcttgcatgtcaactactatcgaccttcttatgatgtttccattgcgagtaaatatgac
atcaataagaaaaaggcaacggtaacaatttcttctgagcaatatagtcctgagataaga
tatacgacagacggaagcgaaccaacaacggcttctacgttatacattgactccttgtcg
ctcgtaaacacaacgactattaaggcagctgtttttaaagattctgtccgttttggtaag
gtggaggattttacagttgatatccataagggaattggtaaaaaaatcgtttacaataat
caatggaatgacaagtatccggcaaagctggatagcagtttattaaatgggcaatacggt
ggtctaagctacggtgacggtgaatggcagggatttttaggtgattttgatgtgacactt
gattttgaacgacgcgaagaactacatgagataaagttgcggttcatgcagcttgcaggg
ccaggggtttatataccgggcagtgtgaaaatattagcctctgatgatggtaagcatttc
cgtgaaatggaaaaaatcgataacgatgtgccgacgaccgatccgtctttacgatttaag
acgtttagtttcgatctggagggtcgacttgcgcgttacattcgtattgtaggccaaaat
aatatgaaaggatttctgtttacagatgaaattgtggtttattga

  All links  
No link information was found.   
DBGET integrated database retrieval system