KEGG   Sphingobacterium sp. 21: Sph21_1149Help
Entry
Sph21_1149        CDS       T01450                                 

Definition
pyruvate dehydrogenase E1 component subunit alpha
Orthology
K00161  
pyruvate dehydrogenase E1 component alpha subunit [EC:1.2.4.1]
Organism
shg  Sphingobacterium sp. 21
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:shg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sph21_1149
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sph21_1149
   00020 Citrate cycle (TCA cycle)
    Sph21_1149
   00620 Pyruvate metabolism
    Sph21_1149
Enzymes [BR:shg01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     Sph21_1149
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1427438..1428433
Genome map
AA seq 331 aa AA seqDB search
MSSTPITKETYLEWYKSMLLMRKFEEKAGQLYGQQKIRGFCHLYIGQEAVVAGAMSVLRK
EDSMITAYRDHAHALAKGMSANAAMAELFGKVTGCSKGKGGSMHFFDKENNFAGGHGIVG
GQIPLGAGLAFAEKYNGTDNVCVCYMGDGAVRQGSLNETFNMAMLWKLPVIFVCENNGYA
MGTSVKRTTNMIDIYKMGLGFDMPSAPVDGMDVVAVHNAMDEAVQRARKGEGPTFLEIRT
YRYKGHSMSDPAKYRTKEELEQYKERDPIAAVKHAIIENKYADEQWFDQEEAEVKRIVDE
AVKFAEESEYPNPEELYTDVYVQNDYPYIMD
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgagttcaacaccaataacaaaagaaacatatctagagtggtataagtcgatgttactt
atgcgtaagtttgaggaaaaagcaggtcaactttacggtcaacaaaaaataagaggcttt
tgccatctatatattggacaggaagccgttgttgcaggtgccatgtcagttcttcgtaaa
gaggactccatgatcactgcttatcgtgaccatgcccatgcccttgccaaaggcatgagc
gccaatgcagctatggcagagttattcgggaaagtaacgggttgttcgaaaggaaagggt
ggatcaatgcacttttttgataaggaaaacaatttcgcgggaggccatggtatcgtagga
ggacaaataccattaggtgcaggtcttgcttttgccgaaaaatacaatggtacagataat
gtttgcgtttgttacatgggagacggagctgtaagacaagggtctttaaacgagaccttt
aatatggcaatgctttggaagcttccggtaatcttcgtttgcgaaaataacggttatgcg
atgggtacttccgttaagcggacgactaacatgattgacatttataaaatgggcttaggc
tttgatatgccaagcgctccggttgatggtatggacgttgtagcagttcataatgcaatg
gacgaagccgttcagcgtgccagaaaaggggaaggaccaacgtttttggagattcgcacc
tatcgttataagggacactctatgtcggatcctgccaaataccgtacaaaagaagaatta
gaacaatataaagagcgcgatccaattgccgcggttaagcacgccattatagagaataag
tatgccgatgagcaatggtttgatcaggaggaagccgaagtaaaacgtattgttgatgaa
gcggttaaatttgctgaggaatctgagtatccaaacccggaagagctatatacagacgtg
tatgtgcagaacgattatccatatattatggattaa

DBGET integrated database retrieval system