KEGG   Sphingobacterium sp. 21: Sph21_1150Help
Entry
Sph21_1150        CDS       T01450                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
shg  Sphingobacterium sp. 21
Pathway
shg00010  Glycolysis / Gluconeogenesis
shg00020  Citrate cycle (TCA cycle)
shg00620  Pyruvate metabolism
shg01100  Metabolic pathways
shg01110  Biosynthesis of secondary metabolites
shg01120  Microbial metabolism in diverse environments
shg01130  Biosynthesis of antibiotics
shg01200  Carbon metabolism
Module
shg_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:shg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sph21_1150
   00020 Citrate cycle (TCA cycle)
    Sph21_1150
   00620 Pyruvate metabolism
    Sph21_1150
Enzymes [BR:shg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Sph21_1150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 DUF2118 GCV_H PYNP_C CENP-B_dimeris
Motif
Other DBs
NCBI-ProteinID: ADZ77719
UniProt: F4CDI4
Position
1428485..1430131
Genome map
AA seq 548 aa AA seqDB search
MAEVVRMPKMSDTMTEGVIAKWHKKVGDKVSSGDLIAEVETDKATMDFESYQEGTLLYIG
PKEGEAVPIDAVIAVLGEEGEDYQALLNGNGGASPSTKEDKKEEEAPAQEETEDEDEGEE
VSAESLGATVITMPLLSDTMTEGVIAEWHFKVGDKIKSDDVIADVETDKATMEVTAYAEG
TLLYIGVEKGQAAKVNDIIAIVGKEGTDVTPLLKQKSSKPKKQEAPKKEEASTSAANEPS
QAESKEVTSSDSSRVKASPLARKIAKEKGIDLNELKGSAENGRIIKKDVESFTPAAKQKT
EAPAAAPSAESKSVTIPQFIGEERFTEKPVTQMRKTIAKRLSESLFTAPHFYVTVKVDMD
SAISARNKINEVAPVKVSFNDLVIKAVAVALKQHPNVNSSWLGDKIRYNEHVNIGVAIAV
DEGLLVPVVRFADGKTLSHISAEVKDFAQRAKAKKLQPKDWEGSTFTVSNLGMFGVDEFT
AIINPPDSCILAIGGIQQVPVVKNGAVVPGNIMKITLSCDHRVVDGATGAAFLQTVKSLL
EEPVRLLV
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atggctgaagtagttcgaatgcctaaaatgagcgacaccatgacagaaggtgtaattgca
aaatggcataaaaaggtaggcgataaggttagctcaggagatttaattgctgaggttgaa
accgataaggctaccatggattttgaatcctatcaggaaggcacactattatatataggt
cctaaggaaggcgaagcagttcctatcgatgctgtaattgccgtattaggagaagaagga
gaagattatcaggcattacttaatggtaatggcggcgcttcgccttcaactaaagaagat
aaaaaagaagaagaggctccggcacaggaagaaacagaagatgaagatgagggtgaagaa
gtaagtgctgaatcattaggtgcaacggtaatcactatgccattgctaagtgatacaatg
accgaaggcgtaattgcagaatggcatttcaaggttggcgacaagattaaaagtgatgat
gtaattgccgacgtagaaacggacaaagcaaccatggaagttactgcttatgctgaaggc
accttactgtacatcggagtagaaaaaggtcaggcagcaaaagttaatgatattattgcc
attgtaggaaaagaaggtaccgatgtaacgcctttgcttaaacagaaaagcagtaaaccg
aagaaacaagaagctcctaaaaaagaagaagcgtcaactagcgcagcaaacgagccaagc
caagcggaaagcaaagaagttacttcttctgactcgtcccgagttaaagcttctccttta
gcgcgaaaaattgcgaaagaaaaaggtattgatttaaatgaactgaaaggttcggcagag
aatggccgtatcatcaaaaaggatgtcgaatccttcacgcctgctgctaaacaaaagact
gaagcaccggctgctgctccaagcgccgaaagtaagtctgttactattccgcaatttatc
ggagaagagcggtttaccgaaaagcctgtgactcaaatgcgtaaaacgattgctaaacgt
ctttcggaaagcttatttactgctccacatttctatgtaacagtgaaagttgacatggat
agcgctatttccgcacggaataaaatcaacgaagttgctcctgttaaggtgtctttcaac
gatttagtcatcaaagctgttgccgttgcgctaaaacaacatcctaatgttaactcttct
tggttgggcgataaaattcgctataatgagcacgttaatattggtgtcgctattgccgtg
gacgaaggcttattagttcctgtggtccgtttcgctgatggaaagacattatcacatata
tcggctgaagtgaaagattttgcacaacgtgctaaagccaaaaaactacagccgaaagac
tgggaaggctctacctttacggtttctaatctgggtatgttcggcgtcgacgaatttacc
gccatcattaatccacctgactcttgtatattagccattggcggcatacaacaggtaccc
gtggttaaaaacggtgcggttgtcccaggcaacatcatgaagattactttaagctgtgac
caccgtgtagtagacggtgctacgggggccgctttcttgcagactgttaaatcactgcta
gaagaacccgttcggttattagtttaa

DBGET integrated database retrieval system