KEGG   Sphingobacterium sp. 21: Sph21_1318Help
Entry
Sph21_1318        CDS       T01450                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
shg  Sphingobacterium sp. 21
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:shg00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1646431..1647087)
Genome map
AA seq 218 aa AA seqDB search
MRNNPMNINNNEAPLDDEELDGYVKIDRYNTDKIESIANHYEDILSQLGENPKRQGLLKT
PERIAKALQYLTHGYDIDPAAILKSAMFEEDYSQMVVVKDIEVYSMCEHHLLPFFGKAHI
AYIPKGHIVGLSKIPRVVDAFARRLQVQERLTNEIRDCIQETLNPAGVAVVIECKHLCMA
MRGIQKQNSVTTTSAFTGEFAHERTRAEFLRLITASLD
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgaggaacaatccgatgaatattaacaataacgaagcccctttggatgatgaggagctt
gatggttatgtaaaaattgatcgttataacaccgataaaattgagagtatagccaaccac
tacgaagacattctatctcaacttggcgaaaacccaaaacgtcagggcctattaaagaca
cccgagcgtattgctaaagccttgcaatacctaacccatggctatgatatcgatcctgct
gccatcttaaaaagcgctatgttcgaagaagattatagccaaatggtggtcgtaaaagat
atagaagtctattcaatgtgtgaacatcatcttttacccttcttcggaaaggcacatatt
gcctacattccaaagggacacattgttggtctcagtaaaatcccgcgggtagtagatgct
tttgcccgccgcttgcaggtacaagaaaggcttaccaatgaaataagggattgtattcaa
gaaacattgaatccggctggagttgcggtagtaatcgaatgcaagcacctgtgcatggct
atgcgaggtatacaaaaacagaactcggttaccactacttctgcatttaccggagaattc
gcccatgaacgcacgagagctgagttcttgcggctgataaccgctagtctagactaa

DBGET integrated database retrieval system