KEGG   Sphingobacterium sp. 21: Sph21_1428Help
Entry
Sph21_1428        CDS       T01450                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
shg  Sphingobacterium sp. 21
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:shg00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Sph21_1428
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sph21_1428
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Sph21_1428
Enzymes [BR:shg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Sph21_1428
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1763598..1764911)
Genome map
AA seq 437 aa AA seqDB search
MNLYSTNNKKLRVSFKEAVFNSLPSDKGLYMPTEIPSLSADFINNLDQFTLPDIAFEVAH
HLIGDSIPANDLRLLVDDAINFEAPVVSLDDRTAVLELFHGPSLAFKDFGARFMSRVMGY
FSKTEENSKLLDVLVATSGDTGGAVALGFLGVEGTRVTILYPKGKVSPIQEQQLTRNGQN
IRAIEVDGTFDDCQALVKEAFNDAELNQQFRLTSANSINIARLIPQTFYYFNAYAQMKRK
GITDIVFSVPSGNFGNIGAGLLAYKMGLPVRQFLAATNVNDTVPRFLSDGYYEPRPSIAT
LSNAMDVGNPSNWVRIMDLFEDDRALLKETVTAYAYSDEETRSAIDELYSSYQYLACPHT
AIAYLAGQAYKKEQGGNYTTIFLSTAHPCKFPDVFSEEKQKAIFIPEQVKELESKPSQKE
ELGADYEAFKQWLQEEL
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgaacctatacagtactaataataaaaagctaagagtttcttttaaagaagccgtattt
aacagtttgccttcagataaggggctttatatgcctaccgagatcccttcgctttctgcg
gattttattaataatcttgatcagtttactttacccgatatcgcttttgaagtggctcac
cacttaattggcgacagcattccggccaatgatcttcgattattagtggatgacgctatc
aactttgaagcacctgtagtatcacttgacgaccgtacggcagtactagagctttttcac
ggaccatcccttgcctttaaagatttcggtgcccgattcatgagtcgcgttatgggttat
ttttctaaaaccgaggaaaacagcaagcttttagatgtattagtagccacttcgggagac
acgggaggagccgtggctttaggttttctaggtgtagaaggcactcgggtaaccatttta
tatcctaagggaaaagtaagccctattcaagagcaacagctgacccgtaacggtcagaat
attcgagccattgaggtcgatggcacttttgacgactgccaggctttggtaaaagaggcg
ttcaatgatgctgaacttaatcaacagttccgattaacatctgccaactcgatcaatata
gcccgtttgattccacagactttttattacttcaatgcctatgcgcaaatgaagagaaaa
ggaataactgatatcgttttttctgttcccagcggaaacttcggtaatattggcgctggc
ttattagcctataaaatgggtttacctgttaggcagtttttagctgctactaacgtgaat
gatacggttccacgtttcctatcagacggctactatgaaccgcgcccctcaatagccacc
ctatctaacgcaatggatgtaggcaatccaagcaactgggttcgcattatggatcttttt
gaagacgatcgcgcgttattgaaagaaacggtaacagcttacgcgtatagcgacgaggag
acccgcagcgctattgacgagctttatagcagctatcaatatcttgcctgcccacacacc
gccatcgcttacttagcagggcaagcttataaaaaagagcaaggtgggaactatacaact
atatttttatcaactgcacacccatgcaagtttcccgatgtattttctgaagaaaaacag
aaagccatcttcatacctgaacaagtaaaagaattggaaagtaaacccagccaaaaagag
gaacttggagctgattacgaagcttttaagcagtggctgcaggaagagttataa

DBGET integrated database retrieval system