KEGG   Sphingobacterium sp. 21: Sph21_1508Help
Entry
Sph21_1508        CDS       T01450                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
shg  Sphingobacterium sp. 21
Pathway
shg00400  Phenylalanine, tyrosine and tryptophan biosynthesis
shg01100  Metabolic pathways
shg01110  Biosynthesis of secondary metabolites
shg01130  Biosynthesis of antibiotics
shg01230  Biosynthesis of amino acids
Module
shg_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:shg00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Sph21_1508
Enzymes [BR:shg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Sph21_1508
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS RTX PIG-X Binary_toxB_2
Motif
Other DBs
NCBI-ProteinID: ADZ78070
UniProt: F4C392
Position
1857659..1858441
Genome map
AA seq 260 aa AA seqDB search
MNILDKIISRKREELLIAKRQVTIDDLMRRPLFDRTCYNLRDSVLDPQRTGIIAEYKRAS
PSKGVINDQVTVEEVTRGYAEAGASAISVLTDRDFFKGSLQDLIKARETVNVPLLRKDFI
IDEYQIAEAKAYGADIILLIAAVLNNEEVESLAKYAKNLGLNVLLEVHNQQELETNLFDT
VDAIGVNNRNLKDFTVSIDHSLALVNRIPESFVKVSESGISDPLVIKQLKKAGFQAFLIG
ENFMKTTDPSASIKQFVNEL
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgaatatactggataagattataagcagaaaaagagaagaactattaattgctaaacgg
caagtaacaatagatgacctgatgcgtcggccacttttcgatcgtacttgttacaatctc
agagactcggtacttgatccgcagagaaccggcattattgcagaatataagagagcctct
ccatcaaaaggcgtaatcaatgatcaggttaccgttgaagaagttaccaggggatatgca
gaggcaggtgcctccgctatttcagttttaactgatcgtgatttctttaagggcagttta
caagatttaataaaagctcgggaaacggtgaatgtacctttgttacgaaaagattttatc
attgacgaatatcagatagccgaagcaaaagcatatggtgccgatatcatattgttaata
gccgctgttttaaataatgaagaggtggaatcgctggccaaatacgctaaaaacttaggt
ttgaatgtgcttttagaagtacataaccagcaggagctggaaacgaatttattcgacacg
gtagatgctattggcgtaaacaaccgaaaccttaaagattttacagtatcaatcgatcac
tcgttagcgctggtgaaccgcattccggaatcctttgttaaagtttcggaaagcggcata
agcgatcctcttgttattaagcaattgaaaaaggcgggttttcaggcgttcttgatcggt
gaaaacttcatgaaaacaacggacccttcagcatcgattaaacagttcgtgaacgaatta
taa

DBGET integrated database retrieval system