KEGG   Sphingobacterium sp. 21: Sph21_1636Help
Entry
Sph21_1636        CDS       T01450                                 

Definition
pantothenate synthetase
Orthology
K01918  
pantoate--beta-alanine ligase [EC:6.3.2.1]
Organism
shg  Sphingobacterium sp. 21
Pathway
beta-Alanine metabolism
Pantothenate and CoA biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Pantothenate biosynthesis, valine/L-aspartate => pantothenate
Brite
KEGG Orthology (KO) [BR:shg00001]
 Metabolism
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Sph21_1636
  Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    Sph21_1636
Enzymes [BR:shg01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.1  pantoate---beta-alanine ligase
     Sph21_1636
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1998313..1999164
Genome map
AA seq 283 aa AA seqDB search
MEIFTTKIALKAHLSAFGSKDKTIGFVPTMGALHEGHLTLIEHSRRATDITVCSIFVNPT
QFNDPADLEKYPRPIEKDVALLQSVNCDVLFLPTVEEMYPPNDEPWFFDLGRLDKIWEGA
KRPGHYQGVTQVVYKLFDIVKPSIAFFGQKDFQQCMVIQYMVDKLHLPLRLQMVDTVRDA
DGLAKSSRNVRLSSNGRKQALSLSKALFMIKQALEKGTGPLQAKEEALSFLDQVEGVELE
YFAICNPSDLSEIDSEQQDLRPLVVILAARVDGVRLIDNIVLK
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
ttggaaatctttactacaaaaattgcgctgaaagcccatctatcagcgttcggttcaaag
gataaaacaataggtttcgtgcctaccatgggggctttacacgaaggtcatttaactttg
attgagcattccaggcgcgcaaccgatattaccgtttgtagtatatttgttaatccaaca
cagtttaatgatccggctgatttggaaaagtatccgagacctatcgaaaaggatgtggca
ctccttcaatcggtgaactgtgatgtcctgtttttacctactgtggaagagatgtatcca
ccgaatgacgaaccttggttcttcgatctgggtcgactcgacaaaatctgggagggagca
aaaagacccggacattatcaaggcgttacacaggtggtgtacaaactctttgatattgtt
aagccctcgatcgccttttttggacagaaagattttcagcagtgtatggtgattcagtat
atggtggataagcttcatctaccgctgcgcctgcaaatggtggataccgtaagagatgcg
gatggattggcgaaaagctcccgcaatgtacgactctcatccaatggtagaaaacaagca
ctttctttatcaaaagcattgttcatgataaaacaagcgcttgaaaagggcacaggcccc
ttacaggcaaaggaggaagcactgagtttcctggatcaagtagaaggtgttgaattggaa
tacttcgcaatctgtaatccgagtgacttatcggaaattgatagtgaacaacaggaccta
aggccgcttgtggttatattggccgctcgggtggatggagtccgtttaattgataatata
gtgttgaaataa

DBGET integrated database retrieval system