KEGG   Sphingobacterium sp. 21: Sph21_1636Help
Entry
Sph21_1636        CDS       T01450                                 

Definition
pantothenate synthetase
Orthology
K01918  
pantoate--beta-alanine ligase [EC:6.3.2.1]
Organism
shg  Sphingobacterium sp. 21
Pathway
beta-Alanine metabolism
Pantothenate and CoA biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Pantothenate biosynthesis, valine/L-aspartate => pantothenate
Class
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:shg00410]
Metabolism; Metabolism of cofactors and vitamins; Pantothenate and CoA biosynthesis [PATH:shg00770]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1998313..1999164
Genome map
AA seq 283 aa AA seqDB search
MEIFTTKIALKAHLSAFGSKDKTIGFVPTMGALHEGHLTLIEHSRRATDITVCSIFVNPT
QFNDPADLEKYPRPIEKDVALLQSVNCDVLFLPTVEEMYPPNDEPWFFDLGRLDKIWEGA
KRPGHYQGVTQVVYKLFDIVKPSIAFFGQKDFQQCMVIQYMVDKLHLPLRLQMVDTVRDA
DGLAKSSRNVRLSSNGRKQALSLSKALFMIKQALEKGTGPLQAKEEALSFLDQVEGVELE
YFAICNPSDLSEIDSEQQDLRPLVVILAARVDGVRLIDNIVLK
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
ttggaaatctttactacaaaaattgcgctgaaagcccatctatcagcgttcggttcaaag
gataaaacaataggtttcgtgcctaccatgggggctttacacgaaggtcatttaactttg
attgagcattccaggcgcgcaaccgatattaccgtttgtagtatatttgttaatccaaca
cagtttaatgatccggctgatttggaaaagtatccgagacctatcgaaaaggatgtggca
ctccttcaatcggtgaactgtgatgtcctgtttttacctactgtggaagagatgtatcca
ccgaatgacgaaccttggttcttcgatctgggtcgactcgacaaaatctgggagggagca
aaaagacccggacattatcaaggcgttacacaggtggtgtacaaactctttgatattgtt
aagccctcgatcgccttttttggacagaaagattttcagcagtgtatggtgattcagtat
atggtggataagcttcatctaccgctgcgcctgcaaatggtggataccgtaagagatgcg
gatggattggcgaaaagctcccgcaatgtacgactctcatccaatggtagaaaacaagca
ctttctttatcaaaagcattgttcatgataaaacaagcgcttgaaaagggcacaggcccc
ttacaggcaaaggaggaagcactgagtttcctggatcaagtagaaggtgttgaattggaa
tacttcgcaatctgtaatccgagtgacttatcggaaattgatagtgaacaacaggaccta
aggccgcttgtggttatattggccgctcgggtggatggagtccgtttaattgataatata
gtgttgaaataa

DBGET integrated database retrieval system