KEGG   Sphingobacterium sp. 21: Sph21_1685Help
Entry
Sph21_1685        CDS       T01450                                 

Definition
2-oxoglutarate dehydrogenase E2
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
shg  Sphingobacterium sp. 21
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:shg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sph21_1685
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Sph21_1685
  Amino acid metabolism
   00310 Lysine degradation
    Sph21_1685
Enzymes [BR:shg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Sph21_1685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2065996..2067555
Genome map
AA seq 519 aa AA seqDB search
MAIEIKVPAVGESITEVTLSQWLKKDGDYVEMDENLAELESDKATFELPAEKAGILRIIA
KEGDTLEIGAVVCTIEEADGKGASTTQNNTTPTATPEAKPATQDNGSTGAPVEIKVPTVG
ESITEVTLSQWLKKDGDYVEMDEDLAELESDKATFELPAEVAGTLQIVAQEGDTLAIGAV
VCKIIPSGKGAAAAASSSASAPATAKEEEEEKEQNYAAGTPSPAAAKILKEKGIDPSTIK
GTGKDGRITKEDALKAEKKAVEPKPAATASAPKAEPSTTAPKAAAGSRDERREKMSSLRK
TIAKRLVSVKNETAMLTTFNEVDMKPIMDLRAKYKDKFKDKYGVGLGFMSFFTKAVTTAL
AEWPAVNARIEDNEIVYSNFADISIAVSAPKGLVVPVIRNAESMTLDEIEKAVRDLALKA
RDNKLTIDEMTGGTFTITNGGVFGSMMSTPIINAPQSAILGMHNIVERPVAINGEVVIRP
MMYVALSYDHRIVDGRESVSFLVRVKELLEDPARLLLGI
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atggcaatagaaataaaagttccagccgtaggcgagtcgataacggaagttaccttatct
caatggctgaaaaaagatggcgactatgtagaaatggatgaaaatttggctgaattagaa
tccgataaagccacctttgaattaccggctgaaaaggctgggatactccgtattattgct
aaagaaggggataccttggagattggtgcggttgtctgcaccattgaagaggcagatggt
aaaggcgcaagcacaacacaaaataatactacgccaacggctacaccggaggcaaaaccg
gccactcaagataatggttcaaccggagctcctgttgaaattaaagtgccgactgtgggc
gagtcgatcaccgaagtgaccttgtcgcaatggctgaaaaaggacggtgattacgtagag
atggatgaagatttggcggaactggaatcggataaagcaactttcgaactgcctgctgag
gtagcagggactttacagattgttgcacaagagggtgataccctcgctataggtgcagta
gtttgtaagattattccgtctggtaagggcgcggcagctgctgcctcaagcagcgcgtca
gctccggctacagcaaaggaagaggaagaagaaaaggaacaaaactatgctgccggaaca
ccttcacccgctgctgctaagattttaaaggagaaaggaattgacccaagtaccattaaa
ggaaccgggaaggacggacgtattacaaaagaagatgccttaaaagccgagaaaaaggcc
gttgagccaaaaccggcagcgacagcgtcggctcctaaggctgaaccatcgacaacagca
cctaaagctgctgccggttcgagagatgaacgtagggagaaaatgtcttcactccgtaag
acgatagccaagcgtttagtttctgttaaaaatgaaacggcgatgctgactactttcaac
gaagtggacatgaagccgatcatggatctgcgcgcaaagtataaggataaattcaaagat
aaatatggtgtgggcctcggctttatgtcattcttcacgaaagccgtaacgacggccttg
gcggagtggcctgcagtaaatgcacggatcgaggataacgagattgtatatagcaatttc
gcggacatctctatcgcggtttctgcaccgaaaggtttagtggtaccggtaatccgtaat
gcagagtccatgaccctagacgaaatcgaaaaagcagttcgcgatttggccttgaaagcg
cgggataacaaattgactattgatgaaatgaccggtggtacctttaccatcaccaacggt
ggtgtgttcggatccatgatgtctacaccgattatcaatgcccctcaatcagccatccta
ggaatgcataacatcgtggaacgtccggtagccattaatggtgaggtcgtgattcgtcca
atgatgtatgtcgccctgtcttatgaccaccgcatcgttgacggacgggaatctgttagt
ttcttggttcgggtgaaggaattgttggaagaccctgctcgtttattattgggcatttaa

DBGET integrated database retrieval system