KEGG   Sphingobacterium sp. 21: Sph21_1910Help
Entry
Sph21_1910        CDS       T01450                                 

Definition
(GenBank) ROK family protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
shg  Sphingobacterium sp. 21
Pathway
shg00010  Glycolysis / Gluconeogenesis
shg00052  Galactose metabolism
shg00500  Starch and sucrose metabolism
shg00520  Amino sugar and nucleotide sugar metabolism
shg00521  Streptomycin biosynthesis
shg01100  Metabolic pathways
shg01110  Biosynthesis of secondary metabolites
shg01120  Microbial metabolism in diverse environments
shg01130  Biosynthesis of antibiotics
shg01200  Carbon metabolism
Module
shg_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:shg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sph21_1910
   00052 Galactose metabolism
    Sph21_1910
   00500 Starch and sucrose metabolism
    Sph21_1910
   00520 Amino sugar and nucleotide sugar metabolism
    Sph21_1910
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Sph21_1910
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Sph21_1910
Enzymes [BR:shg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Sph21_1910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK FGGY_N Hexokinase_2
Motif
Other DBs
NCBI-ProteinID: ADZ78470
UniProt: F4CA44
Position
complement(2327519..2328382)
Genome map
AA seq 287 aa AA seqDB search
MVIGVDIGGTNIRAGLIENGVVIHQNQCALQNKDSMEATLYQLIETIKPLTTQAVEGIGI
GVPSVVDIEQGVVYDVANIPAWKRLELKRIVQERLHLPVKINNDVNCFTLGEYHYGVAKG
IGSLIGVTIGTGMGAGLILNHQLYMGHNCGAGEIGLLPYLNKTLEEYVGSQFFMDRMQKS
AEEIAKEAIGGDHQAMRLWEEFGLHVGEALKIMLYAYDPEVVVLGGSISKAYPLFKKSME
ESMRSFAYSNTLQKVRVLASEHSHIALLGAASLIQFDMNVFAKGTRI
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atggtaataggtgtagatataggaggcactaatattcgtgccggattgatagaaaatggt
gttgttattcatcaaaatcaatgcgcactgcaaaacaaggattcaatggaggctacgctc
taccaacttatagaaacaattaaaccactaaccacccaagccgttgaaggaatcggtatt
ggcgttccatcagtcgtggatattgaacagggcgtggtatatgatgtagcgaatattcct
gcttggaaaaggcttgaattgaaacgaattgtacaggaacggcttcatctgcccgtgaag
ataaataacgacgtgaattgctttaccttaggcgaatatcactatggtgtcgcaaagggg
ataggatcgcttattggcgttacaatcggaacgggtatgggggcagggctgatactcaat
catcagctttatatgggccataattgcggggccggcgaaatcgggctcttaccttacctg
aataaaacactggaagaatatgtaggcagtcagttttttatggatcgtatgcaaaaaagt
gcagaagagatcgcaaaagaagctattggaggtgatcatcaggcaatgaggctttgggaa
gagtttggccttcacgttggcgaggcactgaaaataatgctttacgcctacgatcctgaa
gtggtcgtattaggcgggtccatctccaaggcctaccctctttttaagaaaagcatggaa
gagtcaatgaggtcttttgcttattccaacaccttacaaaaggtgcgcgtgttggcttct
gagcattcgcatatcgcacttttgggcgcagcctccttaatccaatttgatatgaatgta
tttgcaaagggaactaggatttaa

DBGET integrated database retrieval system