KEGG   Sphingobacterium sp. 21: Sph21_2087Help
Entry
Sph21_2087        CDS       T01450                                 

Definition
Holliday junction DNA helicase subunit RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
shg  Sphingobacterium sp. 21
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:shg03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2565036..2565620
Genome map
AA seq 194 aa AA seqDB search
MYEYLNGKLAYKCPTYVVLDVNGVGYHVNISLYTFGKIKDCEQCKLYVSFQVKEDAHSLY
GFAEEGERRLFNHLLSVSGIGASTGRMILSSITPTEIQTAIVQGDVKQIQRIKGIGPKSA
QRIILELQDKLKKEGADTLISVPQHQSVPEEALTALVMLGFNKAQAEKVLTEIQKNNAAQ
FTVEELIKEALRRL
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgtacgaatatttaaatggaaaactggcatacaaatgtcccacgtatgtggtactggat
gtgaatggcgtcggctatcatgttaacatttctttgtatacatttggtaagatcaaggat
tgtgagcaatgtaagctctatgttagttttcaggttaaagaggacgctcactcactatat
ggatttgcagaagaaggagaacgtaggttattcaatcacttactgtctgtttcaggtatt
ggagcgagtacaggacgaatgattctgtcatcgattacaccaactgaaatccaaaccgct
attgtccaaggcgatgtaaagcaaatacaacgcattaaaggaatcggacctaagtctgcg
caacgcattatattagagctgcaagacaagttaaagaaagagggtgccgacaccctgata
tcggttccacaacatcagtctgtacctgaggaggctcttacagccttagtaatgcttggt
ttcaataaagcgcaagctgaaaaagtactaaccgaaattcaaaaaaacaatgccgctcaa
tttaccgtcgaggaattgattaaagaggccttacggaggttataa

DBGET integrated database retrieval system