KEGG   Sphingobacterium sp. 21: Sph21_2180Help
Entry
Sph21_2180        CDS       T01450                                 

Definition
1,4-alpha-glucan-branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
shg  Sphingobacterium sp. 21
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:shg00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Sph21_2180
Enzymes [BR:shg01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Sph21_2180
Exosome [BR:shg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Sph21_2180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2666241..2668166)
Genome map
AA seq 641 aa AA seqDB search
MNTAPHTGPKSRFTAFDLSLFKEGKHYQLYDKLGAHLASETDAQGVHFAVWAPNAEQVSV
VGNFNHWDRTANPMGRRPDDSGIWELFIPDRLEGECYKYYIKGYNGYEVEKGDPYAYAWE
EPPRTASRIAHLNYAWQDESWLEKQRRTDIFTVPLKIYETHIGSWKRHNDDPTSFLSYRQ
LASELPTYCKELGFSHVEFMPVMEHPFYGSWGYQVVGYFAPSSRYGSPQDFMYLVDTLHQ
HDIGVILDWVPSHFPTDEHGLGYFDGTHLYEHADPKKGFHPDWKSSIFNYDRNEVRSFLI
SNALFWLEKYHIDGLRVDAVASMLYLDYSRVEGQWIPNKYGGRENLEAIQFLQELNEAVH
LYCPRAFTIAEESTAWRRVTAPVQLGGLGFDFKWMMGWMHDTLSYFQKDPLYRRYHQGQL
TFSMVYAYSEKFILPLSHDEVVYGKASLLKKMPGDAWQQFANLRLLYAFMYGHPGGKMIF
MGGEFGQSHEWKHDDGLSWDESLGAPNRGLVAFIQDLNKLYQTEPAMHVHNYDPAGFEWN
AIDDAVNSVISWIRKSDEQDDSLLFVANFTPVVRKNYRIGAPKKGFYSEVLNSDNLKYHG
SDVLNDAIIETAPIPYHGRTHSLSLILPPLAVIVLKYQYDE
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
atgaacaccgctccgcataccggccctaagtcacgtttcaccgcatttgatctcagtttg
tttaaggagggcaaacattaccagctttacgataagttgggtgctcaccttgccagcgaa
acggatgcacaaggagttcactttgctgtgtgggcgcccaatgccgaacaagtttccgtt
gtcggcaattttaaccattgggatcgaacggctaatccgatgggacgaagacctgatgat
tccggaatatgggagctattcattcccgatcggttggaaggtgagtgttacaaatactat
attaaaggatacaatggctacgaagtggaaaaaggcgacccctacgcgtatgcttgggaa
gaaccgccgcggactgcatcacgaattgcccacttaaactatgcctggcaggatgagtcg
tggctagaaaaacaaaggcgtaccgatatcttcaccgttccattgaaaatttatgaaacg
catattggttcatggaaacgccacaacgatgatcccacaagctttttaagctatcgccag
ttggcttcagaactaccaacttattgcaaggaacttggattcagccatgtcgagtttatg
cccgtgatggaacatccgttttatggctcctggggctatcaggttgtgggctacttcgca
ccaagcagtcgatatggatcgccacaagactttatgtatctcgtagatacgttgcatcag
cacgatatcggtgtcatactggattgggtaccctcacactttccaacagacgagcacggt
ttaggctattttgatggcacccacctctacgaacacgccgaccccaagaaaggcttccat
cccgactggaaaagcagtatctttaattacgatcgaaacgaagtgcgttcttttctgatc
tccaatgccctcttttggttagaaaagtaccacattgatggcctacgtgtcgacgccgtt
gcttctatgttatacctcgattattcgcgcgtcgaaggccagtggattccgaataagtat
ggaggtagggaaaatttagaagctattcaatttctgcaagagctaaacgaggccgtgcat
ctatattgtccacgggcctttacaatcgcagaagagtcaaccgcctggcgtagagtaaca
gcccccgtacagcttggcggtttgggtttcgatttcaaatggatgatgggttggatgcat
gataccctgtcttactttcaaaaagaccctctttatcgtcgttatcatcaaggtcaatta
accttcagcatggtttatgcctattcagaaaagtttattcttcctttatcgcatgacgaa
gtggtgtatggaaaagcatctttgttaaagaaaatgccgggcgatgcttggcaacaattt
gctaaccttcgtttattatacgctttcatgtacggacatccgggcggaaaaatgattttt
atgggtggtgagtttggtcagtcgcacgaatggaaacacgatgatggtttgagctgggac
gaatctcttggagcgcccaatcgggggctcgtagcgtttattcaggacttaaacaagctt
tatcaaaccgaaccggcgatgcatgtacacaattatgatcccgcgggttttgagtggaat
gcaatagacgatgccgttaacagtgttatcagctggattagaaaaagtgatgagcaagat
gatagtcttttatttgtagctaactttacgcccgtagtgcgtaaaaattaccgcataggt
gcacccaaaaaaggattttatagtgaagtccttaattcagacaatctcaaatatcatgga
agcgatgtgttaaacgatgcaattattgaaactgcccctattccttatcatggtcggaca
cattctttgtccctaatattacctccgctcgctgtgattgtgttgaaatatcaatatgac
gaataa

DBGET integrated database retrieval system