KEGG   Sphingobacterium sp. 21: Sph21_2230Help
Entry
Sph21_2230        CDS       T01450                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
shg  Sphingobacterium sp. 21
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:shg00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Sph21_2230
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Sph21_2230
Enzymes [BR:shg01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Sph21_2230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2739061..2739999)
Genome map
AA seq 312 aa AA seqDB search
MAETAQQLSTKHLLGIKDLSAEDIHLILDTAATFKDVINRPIKKVPSLRDITIANVFFEN
STRTRLSFELAEKRLSADVINFAASSSSVSKGETLIDTVNNILAMKVDMIVMRHPYPGAG
VFLSKHVDAQIINAGDGAHEHPTQALLDAFSIREQYGDVAGKKVAIIGDILHSRVALSNI
LCLQKLGAEVLVCGPTTLIPKYITSLGVKVEHDLLKALHWCDVANMLRIQLERQDINYFP
SLREYSMLYGLNKTILESLDKKITIMHPGPINRGVEITSDVADSQHSIILDQVQNGVAVR
MAVLYLLAGKRV
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaacagcacaacagctaagcaccaaacacttattaggcataaaagacttgtcc
gcagaagatatccacctgatattggacacagcagccacttttaaggatgtcatcaaccgc
ccaatcaaaaaggtaccttcattacgtgatattacaattgccaatgtcttttttgagaac
tcgacacgcaccagactgtcctttgagctcgccgaaaaacgtctgtcggcagatgtcatc
aactttgcggcttcttcttcttcagtcagcaaaggcgaaacactcattgacacggtaaat
aacatcttggcaatgaaggtagatatgattgttatgcgacatccttatcccggtgcaggc
gtttttttaagtaaacatgtcgatgcccaaattataaatgcaggagatggagcacacgag
catccaacacaagccttgctcgatgcgttttctataagagagcaatatggcgatgttgcc
ggaaaaaaagtagccattattggcgatatcttacattcaagggttgccctttccaatatt
ttatgcttacaaaagctcggggccgaagtactggtatgcggtcctacaacgcttattcct
aaatatattacttcgctgggcgttaaagtggagcatgacctgctcaaggcgcttcattgg
tgcgacgtagccaatatgttacgaattcagctggagcgtcaggatatcaattatttcccc
tctttaagagaatattcgatgctgtatggtttgaataaaacgatacttgaatccttagat
aaaaagataaccatcatgcaccccgggccgatcaatcgtggtgtagaaattacaagtgat
gtggccgacagccaacattcgattattctggatcaggttcaaaatggcgtagcagtgaga
atggctgtattgtacctccttgccggaaaacgtgtttaa

DBGET integrated database retrieval system