KEGG   Sphingobacterium sp. 21: Sph21_2327Help
Entry
Sph21_2327        CDS       T01450                                 

Definition
beta-galactosidase
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
shg  Sphingobacterium sp. 21
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:shg00052]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:shg00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:shg00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2862998..2865409
Genome map
AA seq 803 aa AA seqDB search
MFKTITSFFFLYLFALTLYGQEWGKTLFNEQWKFHLGDRPEAKSVDFNDAAWRELDLPHD
WSIEGTFSKEHPSTNQGGALPGGIAWYRKTFHLADTIEGKQVYIDFDGIYRNSEVWINGH
YLGKRPSGYTSFRYDLTPYIKVGKQANVIAVRVDNSQQPNSRWYSGSGIYRNVWLVTKNK
IAVDHWGAFVRSPSVQKERAIIEQQTTFKNLEGKAVSADIVITIFNKENKAVVKKSFPQQ
LPLGTSKANFEVEVPQPILWSPENPYCYQVETQVYVGKQLVDQYRVPLGIRYFSFDAKDG
FSLNGERKRILGVCMHHDLGALGAAINKKAMERQLVLLKEMGANAIRISHNPPAPEFLDL
CDRLGFLVMDEAFDMWRKKKNKFDYSLDFDEWHRQDLIDLIKRDRNHPSVILWSIGNEIR
EQFDSTGRALTQELVAIVRREDNTRPVTAALTETHLEKNFIAQAKALDILGFNYKYEQYD
SLPINFPGQKFIASETTSALATRGHYDLGHDTLRFWPPSAKEKFVKNGNPDFTVSAYDQV
AAYWGTSHEQAWKAVKQRDFMTGLFVWTGFDYLGEPVPYDFPARSSYYGIIDLAGFPKDV
YYMYQSEWTDKPVLHLLPHWNWQAGQTVDVWAYFNQADEVELFLNGRSLGIRKKQGDDIH
VSWKVPFQPGTLKAVSSINGKEVLVKEIKTASTPASIRLTVDKNKLRAGINDLAFVTVDI
MDDKGNPVPIADNEIVFDIQGPGFIAGVDNGFQADLSSLKGNRKRAYNGKCLAIIQAKAN
TGEIILKASAKGLKGAALKLAVD
NT seq 2412 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaaacgattacgtcattcttcttcctctatttatttgccttgacgctgtatggg
caggaatggggtaaaacactctttaatgaacaatggaagtttcatttgggcgatcgaccg
gaagcaaaatcagtggattttaacgatgcagcatggcgggagctggatttgccacacgac
tggagcattgaaggcacattttcgaaagaacacccgtcaactaatcaaggcggcgcgctc
cccggaggcattgcatggtaccgaaagacctttcacttagccgatacgatagagggaaag
caagtatatatcgactttgacggcatttatcgaaatagtgaagtttggattaacggacac
taccttggaaaacggccgagtggttacacgtccttccgctatgatttaacaccttatata
aaagtcggtaaacaagcaaatgtaattgcagttcgggttgacaatagtcagcaacctaat
tcccgttggtactcaggttccggcatttatcggaatgtttggttggtaaccaaaaataag
attgctgtggatcattggggtgcttttgtaaggagcccatcggttcaaaaggagcgggct
attatcgaacagcagactacttttaaaaacctagaaggtaaagctgtatcggcagatata
gtgattacgatatttaataaagagaataaggcagttgttaaaaaaagctttcctcagcaa
ctgcctttgggtacaagtaaggcaaactttgaagttgaagtgccgcagccaatcctttgg
agtcccgaaaacccgtattgttatcaagtcgaaacacaagtttacgttggaaaacaacta
gtagatcaatatagggtaccgctgggtattcgctacttttcttttgatgctaaagatggt
ttttcgctcaacggcgaaagaaaaaggatactaggtgtttgcatgcatcatgatctgggt
gccttgggagcggccatcaataagaaagctatggaaagacaacttgtgctgctcaaagaa
atgggtgctaatgccattcggatatctcataatccaccggcaccggagttcctggattta
tgcgatcgtttaggctttttggtaatggatgaagcctttgatatgtggcggaagaaaaag
aataagtttgactactcgctcgactttgatgaatggcatcgacaagatctgattgacctg
atcaagcgcgaccgtaaccacccgtcggttatcttgtggagtattgggaacgaaatacga
gagcagttcgacagcaccggtagggcgcttacccaagagctggtggctattgtccgtcga
gaggacaatacccgcccggttaccgctgcattaactgaaactcatttggaaaagaacttt
attgcacaggctaaggcattggatattttgggattcaattataagtatgaacaatacgat
agcctgccgatcaattttccgggacaaaagttcatcgcttcggaaacgacctctgcgtta
gcaactcgaggccattatgatttagggcatgataccttacggttctggccaccgagtgca
aaagagaaatttgttaagaacggaaatccggattttaccgtatccgcctatgatcaggtt
gcagcgtattggggcacaagccatgaacaagcatggaaagccgttaagcaacgtgatttt
atgaccggactttttgtttggaccggctttgattatttaggtgagccggtgccttatgat
ttcccggcgcgaagctcttattacggtatcattgatttggcgggctttccaaaggatgta
tactatatgtaccaaagcgaatggactgataagcctgtgttgcatttattgccacattgg
aactggcaagcggggcaaaccgttgatgtctgggcttattttaaccaagccgatgaagtg
gagctttttctaaatggtcgatcgctgggaatccgaaaaaaacaaggggacgatatccat
gtttcctggaaggttccttttcaaccaggaacgttaaaagccgtttccagcataaatgga
aaggaggttttagtaaaagaaattaaaaccgcttccacaccagccagcattcggctcacg
gtagataaaaataaattgcgtgcagggataaatgatctagcgtttgttacggtggacatc
atggacgacaagggaaatccggtacctatagcagataatgaaattgtgtttgatatacaa
ggaccaggatttatagcaggagttgataatggctttcaggcggatttatcctcgctgaaa
ggaaaccgaaagagggcgtataacggcaaatgcctagctattattcaagctaaagcgaac
acaggagaaatcattttaaaagcaagcgcaaaagggttaaaaggagcggcgttgaagctg
gcggtagactag

DBGET integrated database retrieval system