KEGG   Sphingobacterium sp. 21: Sph21_2471Help
Entry
Sph21_2471        CDS       T01450                                 

Definition
dolichyl-phosphate beta-D-mannosyltransferase
Orthology
K00721  
dolichol-phosphate mannosyltransferase [EC:2.4.1.83]
Organism
shg  Sphingobacterium sp. 21
Pathway
Metabolic pathways
Brite
Enzymes [BR:shg01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.83  dolichyl-phosphate beta-D-mannosyltransferase
     Sph21_2471
Glycosyltransferases [BR:shg01003]
 N-Glycan biosynthesis
  Dol-P-Man biosyntheisis
   Sph21_2471
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3050280..3051011)
Genome map
AA seq 243 aa AA seqDB search
MSDSIVIIPTYNEKENIERIIRKVFSLSFPYHILVIDDGSPDGTADIVRGLQAAFNGSLH
LEERRGKLGLGTAYIHGFNWCLERDYLYIFEMDADFSHNPDDLIRLREACIEGADLAIGS
RYIKGVNVVNWPMKRVLISYFASGYVRLITGTDIRDATAGFVCYKRKVLETIPLDKIKFV
GYAFQIEMKFTTLKYGFKVVEVPIIFTDRTEGTSKMSTKIFREAFFGVIQMKVNSWFRKY
NRP
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
gtgtcagacagcatcgttatcatacccacttacaacgaaaaggagaatatagaaaggatt
atccgcaaagtgttttcgctttcttttccttatcacattttagttattgacgatggatcg
cctgatggaacggctgatattgtaaggggtttacaagcagcgtttaacggttccctacat
ttagaagagcggagaggaaagctcgggctgggtacggcttacatccatggatttaattgg
tgtctagaaagagattatctgtatatattcgagatggacgctgatttttcacacaatccg
gatgaccttatccgcctacgggaggcatgtatcgaaggagccgacctggccattggatca
cgttacatcaaaggggtaaacgtggtaaactggcctatgaaaagggtgttaatatcttat
tttgcttcggggtacgtacgattgattaccgggaccgacattcgtgatgccaccgccggt
tttgtgtgttacaaacgcaaggtacttgaaactataccgctcgacaagatcaaatttgtg
ggctatgccttccagatagaaatgaaattcaccaccttgaagtatgggtttaaagtagtg
gaagttccgatcatttttacggatagaacggaaggtacatcaaaaatgagtaccaaaatc
tttcgggaggccttcttcggtgttatacagatgaaagttaacagttggtttagaaaatac
aacaggccctaa

DBGET integrated database retrieval system