KEGG   Sphingobacterium sp. 21: Sph21_2539Help
Entry
Sph21_2539        CDS       T01450                                 

Definition
dihydrolipoyllysine-residue acetyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
shg  Sphingobacterium sp. 21
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:shg01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:shg00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:shg00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3131135..3132478
Genome map
AA seq 447 aa AA seqDB search
MARYNLLLPAMGESVSEATIINWVKQPGDIVNVDDIIVEIATDKVDSEVPSPVAGKLIEQ
RFQHDEVVQVGDVLAVLEMEGDDEESAMSAATLNEPLIEEKIPSISTEIPGMQQLVTDDR
VKEEEPVGDAGRFYSPLVRNIAQEEGISTDELERIQGTGLDGRVTKQDLLDYLAKRASQT
DQEGQVSDEGVGSPNPPEPVKNIEPAAVSVSGKDEIIEMDRMRRLIAEHMVHSVQTAPHV
CSFVEADVTNLVNWRNKIKDSFQQRENEKLTFTPIFIEAVVKAIKDFPMINISVKGTQII
KKHDINIGMATALPNGNLIVPVIKNAKDLSLVGITKSVNDLAFRARNNKLKPDETQGGTF
TLTNIGSFGNVMGTPIINQPQVAILAVGTITKKPAVIETEFGDVIGIRHMMFLSLSYDHR
VVDGALGGMFVRRVADYLEKWDMSRTV
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atggctagatataatttactccttccggcgatgggcgaaagtgtgtctgaagcaactata
ataaattgggtaaaacaacctggtgatatagtaaatgtcgacgatatcatcgtagaaatt
gcaacagacaaggtcgactctgaagtgccatcacccgtagccgggaaattgattgagcag
cgctttcaacatgacgaagtggttcaagttggagatgtccttgccgttttggagatggag
ggggatgatgaagaatcggcgatgagtgcagccacattaaatgagcctttgatagaagaa
aaaattccttctattagcacggaaattccagggatgcagcaattagtaacggatgatcgg
gtgaaggaagaggaaccggtaggggatgcgggccgtttttactcacccttagttcgcaat
attgcccaggaggaaggcatatcaacagacgaacttgagcgtattcaaggtacgggattg
gatggtcgtgtcactaagcaagatttactggattatctggccaaacgggctagtcaaact
gatcaagaggggcaggtttccgatgagggagtaggttctcctaatccgcccgagcctgtg
aaaaatatcgaaccggcagcggtgagcgtttcgggaaaggatgagattattgaaatggat
agaatgaggcggcttattgccgagcatatggttcatagcgtacaaacagctccgcatgtt
tgctcatttgtagaagcagacgttaccaatttggtgaattggcgaaataagatcaaagat
agttttcaacagagagaaaatgaaaagctcacttttacgcctatctttatcgaagctgtc
gtaaaagcaattaaagattttcccatgattaatatttcggtgaaaggtactcagattatt
aaaaagcatgatatcaatatcggtatggcgacagccctgccaaatggcaacctgattgta
cctgtcattaaaaatgcgaaggatttaagtttggtgggaatcacgaaatcggttaatgat
ctggcttttcgtgctagaaataataaattaaaacctgacgagacccaaggaggtactttc
accttaactaacataggttctttcggaaatgtaatgggaacgcctattattaatcagcca
caagtcgctattttagctgtagggacgatcacgaaaaagccggcagttattgaaactgaa
ttcggagatgtcataggcattcgacatatgatgtttttatccttgtcctatgatcatcgt
gtcgtagatggtgccctgggcggcatgtttgtacgccgtgtagcggactatctggagaaa
tgggatatgagtagaacggtttga

DBGET integrated database retrieval system