KEGG   Sphingobacterium sp. 21: Sph21_2539Help
Entry
Sph21_2539        CDS       T01450                                 

Definition
dihydrolipoyllysine-residue acetyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
shg  Sphingobacterium sp. 21
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:shg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sph21_2539
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Sph21_2539
  Amino acid metabolism
   00310 Lysine degradation
    Sph21_2539
Enzymes [BR:shg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Sph21_2539
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3131135..3132478
Genome map
AA seq 447 aa AA seqDB search
MARYNLLLPAMGESVSEATIINWVKQPGDIVNVDDIIVEIATDKVDSEVPSPVAGKLIEQ
RFQHDEVVQVGDVLAVLEMEGDDEESAMSAATLNEPLIEEKIPSISTEIPGMQQLVTDDR
VKEEEPVGDAGRFYSPLVRNIAQEEGISTDELERIQGTGLDGRVTKQDLLDYLAKRASQT
DQEGQVSDEGVGSPNPPEPVKNIEPAAVSVSGKDEIIEMDRMRRLIAEHMVHSVQTAPHV
CSFVEADVTNLVNWRNKIKDSFQQRENEKLTFTPIFIEAVVKAIKDFPMINISVKGTQII
KKHDINIGMATALPNGNLIVPVIKNAKDLSLVGITKSVNDLAFRARNNKLKPDETQGGTF
TLTNIGSFGNVMGTPIINQPQVAILAVGTITKKPAVIETEFGDVIGIRHMMFLSLSYDHR
VVDGALGGMFVRRVADYLEKWDMSRTV
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atggctagatataatttactccttccggcgatgggcgaaagtgtgtctgaagcaactata
ataaattgggtaaaacaacctggtgatatagtaaatgtcgacgatatcatcgtagaaatt
gcaacagacaaggtcgactctgaagtgccatcacccgtagccgggaaattgattgagcag
cgctttcaacatgacgaagtggttcaagttggagatgtccttgccgttttggagatggag
ggggatgatgaagaatcggcgatgagtgcagccacattaaatgagcctttgatagaagaa
aaaattccttctattagcacggaaattccagggatgcagcaattagtaacggatgatcgg
gtgaaggaagaggaaccggtaggggatgcgggccgtttttactcacccttagttcgcaat
attgcccaggaggaaggcatatcaacagacgaacttgagcgtattcaaggtacgggattg
gatggtcgtgtcactaagcaagatttactggattatctggccaaacgggctagtcaaact
gatcaagaggggcaggtttccgatgagggagtaggttctcctaatccgcccgagcctgtg
aaaaatatcgaaccggcagcggtgagcgtttcgggaaaggatgagattattgaaatggat
agaatgaggcggcttattgccgagcatatggttcatagcgtacaaacagctccgcatgtt
tgctcatttgtagaagcagacgttaccaatttggtgaattggcgaaataagatcaaagat
agttttcaacagagagaaaatgaaaagctcacttttacgcctatctttatcgaagctgtc
gtaaaagcaattaaagattttcccatgattaatatttcggtgaaaggtactcagattatt
aaaaagcatgatatcaatatcggtatggcgacagccctgccaaatggcaacctgattgta
cctgtcattaaaaatgcgaaggatttaagtttggtgggaatcacgaaatcggttaatgat
ctggcttttcgtgctagaaataataaattaaaacctgacgagacccaaggaggtactttc
accttaactaacataggttctttcggaaatgtaatgggaacgcctattattaatcagcca
caagtcgctattttagctgtagggacgatcacgaaaaagccggcagttattgaaactgaa
ttcggagatgtcataggcattcgacatatgatgtttttatccttgtcctatgatcatcgt
gtcgtagatggtgccctgggcggcatgtttgtacgccgtgtagcggactatctggagaaa
tgggatatgagtagaacggtttga

DBGET integrated database retrieval system