KEGG   Sphingobacterium sp. 21: Sph21_2623Help
Entry
Sph21_2623        CDS       T01450                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
shg  Sphingobacterium sp. 21
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:shg00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Sph21_2623
Enzymes [BR:shg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Sph21_2623
Exosome [BR:shg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Sph21_2623
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3225966..3227459
Genome map
AA seq 497 aa AA seqDB search
MTASSCILAIDQGTSGTKSLVFDSKGNICAEATIPLKTSYFGEGFVEQHPEDIYKNVLQS
VRACLQQYQSTGASLSAIASCGISNQRETFLLWDEFGSPLCNAVVWQCKRSVDVCYEMQS
LDLGNVIHDKTGLFIDPYFSGTKLIWLYRNNPEIQKAIKAGKAYFGTVDTWLLYRLTKGE
AYLTDYTNASRTLLFNLNTLSWDRELIALFGLEGIRLPEVKPSSYAFGSSHFEGLFKRAL
PVQAMIGDSHAAAFGEACIYPGTAKATLGTGCSILFNVGTERRNSNSGMVSTICWSTEDR
VDYALEGIIVSCASPLAWLKTELGLLTDFAEAENMATSVTDNNGVYLIPAFSGLGAPFWD
MNRKASLEGLTFSSNKNHIVRAALESIAYQIQDVLSAMKQDTGIPIQELMVNGGASSNNF
VVQFLSDLLEAKVIRNENKNVSAFGAGFLAGLKANIFPDLDSVQSLYHRHPIAKTTQVAK
VAEAYRGWQRFIHATKS
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgacagcaagttcttgtattttagcgatcgatcaaggcactagcggtacgaagtcgctt
gtttttgacagtaaagggaacatttgtgcagaagcaacaatccccttaaaaacaagttat
tttggcgagggctttgtagagcagcatccggaagatatttataaaaatgttttacagtct
gttcgtgcttgtttgcagcagtatcaatctaccggtgcctctttgtcggcgatcgcttcc
tgtggcatttccaatcaacgcgaaacctttcttctttgggacgaatttggttcacctttg
tgcaacgcggtggtatggcaatgtaagcgatcggttgatgtttgttatgagatgcaaagt
ctggatttaggtaatgttatacatgataaaacgggtttattcattgatccttatttttca
ggcactaaactgatttggttataccgcaataatcccgaaatccaaaaggctattaaggcg
ggtaaagcttattttgggacggttgatacatggttgctctatcgtttaactaaaggagag
gcttatcttaccgattataccaatgcttcgcgtaccttgttatttaacttaaatacactg
agttgggatcgggaattaatcgctctttttggcttggagggcatccgattgccagaggtt
aaaccttcgtcctatgcattcggatcgagtcattttgaaggattgttcaaacgagcactt
cctgtccaggcaatgattggtgattcgcatgccgccgcttttggagaggcatgcatctat
ccgggtaccgccaaagccactttgggtacaggttgttcgattctattcaacgtaggaacc
gagcgccgaaattctaattccggaatggtttcaaccatctgctggagtacggaggatcgg
gtagactatgcgttggagggtattatcgtatcctgcgcctcacctttggcatggttaaaa
acggaacttgggttgcttactgatttcgcggaggcggaaaacatggcaacatcggtaact
gacaacaatggcgtttacctaatacccgcttttagcggtttaggcgctcctttctgggat
atgaacagaaaagcctctttggaaggtttaacgttttcgagcaataagaaccatatcgtg
cgtgcagcgttggagtccattgcctaccaaatacaagatgtgttatctgccatgaaacaa
gatacgggtattcctattcaagaacttatggtgaacggaggtgcgagtagcaataacttc
gttgtgcagtttttaagtgatttactggaggcaaaagtcatcaggaacgaaaataaaaat
gtatccgctttcggtgccggttttctggcaggcctcaaggcgaacatttttcctgacctg
gatagcgttcaatctctttatcatcggcatcctattgcgaagactacgcaagtagcaaag
gtagccgaagcttatcgtggatggcaacgatttatacatgcgacaaagtcctga

DBGET integrated database retrieval system