KEGG   Sphingobacterium sp. 21: Sph21_2656Help
Entry
Sph21_2656        CDS       T01450                                 

Definition
endo-1,4-beta-xylanase
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
shg  Sphingobacterium sp. 21
Brite
Enzymes [BR:shg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     Sph21_2656
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3283895..3285013
Genome map
AA seq 372 aa AA seqDB search
MLYRKSKTNAINSSPTNAICLFLFVLLCVQSLMAQDNTKGLKDYYQEFFPIGVAVNGRSL
AGQEAHLLLQEFNSITPENAMKMEVIHPRKLEYNWALADSIVAFAQKNRLRVRGHTLLWH
EQVPDWFFLDDQGAPVTKDTLLKRLKDHITTVVGRYKGKVYAWDVLNEAIDDNPKQFLRQ
SKWLEIAGEEILAKAFEYAHEVDPDALLFYNDYNSERPEKRERIYRLVKKLVDDGVPIHG
IGLQGHWSIFEPSTSDLEQAIERYASLGLQLHFTELDVSVYPWEKERRRKRPGEIDALTP
ALEEKQIAQYEMIFSVFRKYKSHITSVTFWNLSDRYSWLDHYPVQGRKNYPLLFDRNLER
KKAYYKVVDFKN
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgttatatcggaaatcaaaaacaaacgcaatcaattcatctcctacaaacgccatttgt
ttattcttattcgtgcttttatgtgtgcagtcgctgatggcacaagataacacaaaagga
ttgaaagactattatcaagaattttttcctataggcgtagcggtcaatgggcggtcgctt
gcaggacaagaggcccatttattactacaggagtttaatagtattacgccggagaacgcc
atgaaaatggaagtgatacacccccgaaaactggaatataattgggctcttgctgatagt
atcgttgcctttgcgcagaaaaatcgattgcgtgttagaggacatacactgctttggcat
gagcaggtccctgattggttttttcttgatgatcaaggagctcctgtgacaaaagatact
ttattaaaaaggctgaaagatcatattactacggtggttgggcggtacaaagggaaagtt
tatgcttgggatgtgctgaatgaagctatcgatgacaatccgaagcagtttctgcgtcag
tctaagtggttggagattgccggtgaagagatactggcgaaggcgtttgagtatgcgcat
gaagttgatccggatgcgctcttgttttataacgattataacagcgaacgtccggagaag
agagagcggatatatcgtttggtgaaaaaactagtggatgacggtgtccctattcatggg
atcgggttgcaggggcattggtcaattttcgagccttctacttctgatctggaacaagcc
attgaacgttatgcttcacttggtttgcaactgcattttaccgaactggatgtgtccgta
tatccttgggaaaaagaaagaagaaggaagcgtccgggtgagatcgatgctttaacccca
gcgcttgaagaaaagcaaatagcacagtatgaaatgatcttttccgttttcagaaaatat
aaaagtcatattaccagtgtgaccttctggaatttatcggaccgttattcgtggttagat
cattatcctgtacagggtaggaagaattatcccttgctatttgatcgcaatcttgaacgt
aaaaaagcttactataaagtcgttgatttcaaaaactag

DBGET integrated database retrieval system