KEGG   Sphingobacterium sp. 21: Sph21_2761Help
Entry
Sph21_2761        CDS       T01450                                 

Definition
(GenBank) Arginase/agmatinase/formiminoglutamase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
shg  Sphingobacterium sp. 21
Pathway
shg00220  Arginine biosynthesis
shg00330  Arginine and proline metabolism
shg01100  Metabolic pathways
shg01110  Biosynthesis of secondary metabolites
shg01130  Biosynthesis of antibiotics
shg01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:shg00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    Sph21_2761
   00330 Arginine and proline metabolism
    Sph21_2761
Enzymes [BR:shg01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Sph21_2761
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: ADZ79308
UniProt: F4C1N5
Position
complement(3409603..3410502)
Genome map
AA seq 299 aa AA seqDB search
MKNVYILECPSNLGLKEPYPGREPGVRMLPDWLKQWGLYDSIPSIRVTRLEAPAYTMNLD
RESGIRNADAIVDYALTQKRFFEKEIKDSVFPFVLGGDCSVLLGPLLALAERGRHALFYL
DGHTDFIWPSLSQTGGAGGMAAAFAAGRGPEKMTNISSLKPYIDEQHVWCVGNREYVDWY
EQAIIESKATYIPLYQLRSRGIQSCVASFLNHVEKEELSGFWIHFDVDVLNDKLMPAVDS
RSPDGLAYEELVELLVPLLDSPKVAGMTLTILDPDLDPSGLHTKKFVEQISYIFKEICG
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacgtttatattcttgaatgtccttctaatttagggctcaaagaaccttatccg
gggcgcgagccgggggtaaggatgttacccgattggttaaaacaatggggtttatacgac
agcattcccagcatacgggttactaggcttgaggctccggcctacacgatgaatttagat
agggaaagcgggattcgcaatgccgatgctatcgtcgattatgcacttactcaaaagcgt
ttttttgaaaaggaaattaaagattccgtattccctttcgttctaggtggagattgcagc
gttttactggggccgttattagctttggctgaacggggccgccatgcattattttattta
gatggccatactgactttatttggccttctttatcgcaaactggcggtgcaggtggcatg
gcggcagctttcgctgcgggtcgtgggcccgaaaagatgaccaatatatcaagtttgaaa
ccctacatcgacgagcaacatgtttggtgcgtgggaaatagagaatacgtagattggtat
gagcaggccattattgaatcaaaggcgacttatattccattgtaccaactaaggtcaagg
ggcattcaatcttgtgttgcctcctttttaaatcatgtcgaaaaagaagaattgtccggt
ttttggattcattttgatgtcgatgtactgaacgacaagttgatgccagcagtagacagt
agaagccctgatggtttggcttacgaagaattagtggaattacttgttcctttgctcgat
agtccaaaagttgccggaatgacacttactattttggatccggacctagatccctcgggt
ttgcataccaaaaaatttgtagagcaaataagctacattttcaaggaaatctgcggttaa

DBGET integrated database retrieval system