KEGG   Sphingobacterium sp. 21: Sph21_2761Help
Entry
Sph21_2761        CDS       T01450                                 

Definition
arginase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
shg  Sphingobacterium sp. 21
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:shg00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Sph21_2761
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Sph21_2761
Enzymes [BR:shg01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Sph21_2761
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3409603..3410502)
Genome map
AA seq 299 aa AA seqDB search
MKNVYILECPSNLGLKEPYPGREPGVRMLPDWLKQWGLYDSIPSIRVTRLEAPAYTMNLD
RESGIRNADAIVDYALTQKRFFEKEIKDSVFPFVLGGDCSVLLGPLLALAERGRHALFYL
DGHTDFIWPSLSQTGGAGGMAAAFAAGRGPEKMTNISSLKPYIDEQHVWCVGNREYVDWY
EQAIIESKATYIPLYQLRSRGIQSCVASFLNHVEKEELSGFWIHFDVDVLNDKLMPAVDS
RSPDGLAYEELVELLVPLLDSPKVAGMTLTILDPDLDPSGLHTKKFVEQISYIFKEICG
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacgtttatattcttgaatgtccttctaatttagggctcaaagaaccttatccg
gggcgcgagccgggggtaaggatgttacccgattggttaaaacaatggggtttatacgac
agcattcccagcatacgggttactaggcttgaggctccggcctacacgatgaatttagat
agggaaagcgggattcgcaatgccgatgctatcgtcgattatgcacttactcaaaagcgt
ttttttgaaaaggaaattaaagattccgtattccctttcgttctaggtggagattgcagc
gttttactggggccgttattagctttggctgaacggggccgccatgcattattttattta
gatggccatactgactttatttggccttctttatcgcaaactggcggtgcaggtggcatg
gcggcagctttcgctgcgggtcgtgggcccgaaaagatgaccaatatatcaagtttgaaa
ccctacatcgacgagcaacatgtttggtgcgtgggaaatagagaatacgtagattggtat
gagcaggccattattgaatcaaaggcgacttatattccattgtaccaactaaggtcaagg
ggcattcaatcttgtgttgcctcctttttaaatcatgtcgaaaaagaagaattgtccggt
ttttggattcattttgatgtcgatgtactgaacgacaagttgatgccagcagtagacagt
agaagccctgatggtttggcttacgaagaattagtggaattacttgttcctttgctcgat
agtccaaaagttgccggaatgacacttactattttggatccggacctagatccctcgggt
ttgcataccaaaaaatttgtagagcaaataagctacattttcaaggaaatctgcggttaa

DBGET integrated database retrieval system