KEGG   Sphingobacterium sp. 21: Sph21_2885Help
Entry
Sph21_2885        CDS       T01450                                 

Definition
pectinesterase
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
shg  Sphingobacterium sp. 21
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:shg00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Sph21_2885
   00500 Starch and sucrose metabolism
    Sph21_2885
Enzymes [BR:shg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     Sph21_2885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3576724..3577722)
Genome map
AA seq 332 aa AA seqDB search
MKRIALLIIIFGCIFHHSIFSQTVYPDRFIVSQEGDGDFRTIQEAVNAVRDLSQQQVRIY
IRKGVYREKIVIPSWKTNISFIGDGTGQTIITNADYSGKPYTDTVDAFGKKAFTTYNSYT
VLVQGNDFTAEGLTIQNTAGRVGQAVALHVEADRVVIKNCRLLGNQDTLYTATENSRQYY
VNCYIEGTTDFIFGQATAVFQWCTIHSLSNSYITAASTTPRQAFGFVFLNCKFTADKEAT
KVYLGRPWRPYAKTVFIRCYMGPHILPQGWDNWRNPANESTAYYAEFHSEGPGAHAAARV
KWSKQLTEKDIESYTLKQIFNYQDPWNPTTNK
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgaagaggatcgcactattgattattatattcggctgtatatttcatcattcgattttt
tcccaaaccgtttatccggatcgctttattgttagccaagagggcgatggcgacttccgt
acgattcaagaagcagtcaatgccgtgcgcgacttatcacagcaacaggttcggatttat
atccgaaaaggtgtttatagagaaaagatagttatcccgtcatggaaaacgaatatttct
ttcattggagacggtaccgggcaaacaatcattactaacgcagactattccgggaagccc
tatacggatacggttgatgcctttggaaaaaaagcctttacaacctataattcatatacg
gttttggtgcagggaaatgattttaccgctgaaggactgacaatacaaaatacagcgggt
cgcgttggccaagcagtggctttgcatgtggaagcggatcgggttgtcataaaaaactgc
aggctcttggggaatcaagacacactctatacagccacggaaaacagtcgacaatactac
gtcaattgttatattgaaggaaccaccgattttatatttggacaggctactgcagttttt
caatggtgtactattcatagtttaagtaactcgtatattacagcagcatccacaacaccg
cgacaagccttcggttttgtctttttaaattgcaagtttactgcagataaagaagcaacg
aaggtgtatcttggccgaccttggcgcccttatgccaagacagtctttatacgctgctat
atgggtccacatatccttccgcaaggatgggacaactggcgtaacccggcaaacgaatca
actgcttattatgcagaattccacagtgaaggaccgggagctcatgcagcagctcgcgtg
aaatggagtaaacagctgacagaaaaagacatagaatcttatacgcttaagcagatattc
aattaccaggatccttggaatccgacaactaacaagtaa

DBGET integrated database retrieval system