KEGG   Sphingobacterium sp. 21: Sph21_2908Help
Entry
Sph21_2908        CDS       T01450                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
shg  Sphingobacterium sp. 21
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:shg00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3617568..3619082)
Genome map
AA seq 504 aa AA seqDB search
MSQSKYILSLDQGTTSSRAIIFNHQGEIVSIAQKEFTQFYPKSGWVEHDPREIWSSQIAV
IAEALVKAEVKSVDIAAIGITNQRETTIVWDRETGKPIYNAIVWQDRRTAPYCDELKEQG
YEELIRKKTGLLIDSYFSATKIRWILNNVDGAREKAENGKLLFGTVDSWLIYNLTDGEKH
VTDVTNASRTMLYNISTMQWDKELLDLFEIPASMLPEVKSSSEIYGQTAGKILTDRIPIA
GIAGDQQAALFGQLCTSEGMVKNTYGTGCFMLMNIGNKPIVSKNNLVTTIAWKIGSQVTY
ALEGSIFIAGAIVQWLRDGLGIIKSSEEVEALASKVEDTDGVYLVPAFAGLGAPHWDSYA
RGTMVGLTRGSNASHIARAALEGIAFQTVDILKAMEADAGKEIHELRVDGGATNNNLLMQ
FQADILQAAVVRPKITEITAIGAAYLAGLAVGYWKDMDDLKDQWQIDKTFKPDVKIDIEN
RMQAWHRAVEAAKAWARLENQSAN
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgagccaaagcaaatatatactttcacttgatcaaggcacaacaagttctcgtgctatt
atttttaaccaccagggagagattgtatccatcgcgcaaaaagagtttacacagttttat
cctaaatccgggtgggtagaacatgatccgcgagaaatttggtcttcgcaaatagccgtt
atcgccgaggccttggtaaaggcagaagttaaatcagtagatatagcggccatcgggatt
actaaccaacgcgaaacaacaattgtttgggatcgtgaaaccggcaagcctatttataac
gccattgtctggcaagacagacgaaccgctccctattgcgacgaacttaaagaacaaggt
tatgaggagcttatcagaaagaaaaccggattattaatagactcttacttctccgcaaca
aagatccgttggatcttgaataacgtagatggagcgagagaaaaggccgaaaacggaaag
ctactcttcggtaccgttgatagctggcttatatataatttgacggatggagaaaagcat
gttactgatgtaacaaatgcatcccgtacgatgctatataatatttcaaccatgcaatgg
gataaagaactgttggatctttttgaaatacccgcaagcatgcttccagaagttaagtca
tcgagcgaaatctatggacaaaccgcaggaaaaatactgactgatcgcattccgatagcc
ggcattgcaggcgaccaacaggctgcactcttcggacaattatgtacaagcgaaggaatg
gtaaaaaacacttatgggacaggttgctttatgctaatgaatatcggcaataaaccaatc
gtttcaaagaataatttggtgactaccatagcatggaaaatcggcagccaggtgacttac
gccttagaaggtagcatttttattgccggggccatcgtacagtggcttcgtgatggtctg
ggcattattaaatcgtctgaagaagtggaggccttagccagtaaggtggaagatacggac
ggtgtatatctagttcctgcctttgcgggtctcggtgctccgcattgggattcctacgct
agagggacaatggttggattgacaagaggtagcaatgcgtcccacattgctcgcgccgcg
ttggaaggaatcgctttccaaacagttgacatattaaaggctatggaagcagatgcagga
aaagaaatccacgaattacgtgtagacggtggcgctactaacaacaatctgcttatgcaa
ttccaggcagatattttgcaagcagcggtcgtacgaccgaaaatcaccgagattacggct
atcggagcagcttatcttgcaggcttagcggttggctattggaaagacatggatgatttg
aaagatcaatggcaaatcgacaaaacctttaaacccgatgttaaaatcgatattgaaaat
cgtatgcaagcttggcatcgcgctgtcgaagcggcgaaagcctgggcaagattggaaaat
caatcggccaattag

DBGET integrated database retrieval system