KEGG   Sphingobacterium sp. 21: Sph21_2923Help
Entry
Sph21_2923        CDS       T01450                                 

Definition
chemotaxis protein CheB
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
shg  Sphingobacterium sp. 21
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:shg00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Sph21_2923
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Sph21_2923
Enzymes [BR:shg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Sph21_2923
Two-component system [BR:shg02022]
 CheA family
  CheA-CheYBV
   Sph21_2923
Bacterial motility proteins [BR:shg02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Sph21_2923
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3633892..3634467
Genome map
AA seq 191 aa AA seqDB search
MQNKEVSIELLIIACSAGGMMLFMDLLSSLKEDVGFAVLVIVHRNEKYASSLEQMAQHKC
VLRVKSAEEKETLQAGTVYFAPAGYHLLIEKDRSISLDASEPVHYCRPSIDVSMQSAAEV
YKKSLVAILLSGANKDGAEGLRAVYKYGGKTLVQDPSAALVDVMPRAAIETGAVTAVLLD
EQLKAYCKSLS
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaataaagaagttagcattgaattgttaatcatcgcttgttcagcgggaggaatg
atgctttttatggatttgttgtctagcttgaaggaagatgtcggctttgcggtgttggtc
attgttcaccgaaacgaaaagtatgcaagctcgttggaacaaatggcacagcataaatgt
gtacttcgggtgaaatcggcagaagaaaaagaaacattacaagcaggtacagtttatttt
gcgccggcaggatatcacctattaattgaaaaagatcgcagtatatctttagacgcatca
gaaccggtccattactgtaggccgtctattgatgtcagcatgcaaagtgccgccgaagtt
tataaaaaatcactggtggcaatcctattgtcaggagccaataaggacggtgccgaaggc
ctacgagctgtttacaagtatggcggcaagacccttgtacaggatccgagtgccgcattg
gttgatgtaatgccgcgggcggccattgaaacaggtgctgttaccgcagttcttttggac
gaacaattgaaagcatattgtaagagccttagttga

DBGET integrated database retrieval system