KEGG   Sphingobacterium sp. 21: Sph21_2923Help
Entry
Sph21_2923        CDS       T01450                                 

Definition
chemotaxis protein CheB
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
shg  Sphingobacterium sp. 21
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:shg02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:shg02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3633892..3634467
Genome map
AA seq 191 aa AA seqDB search
MQNKEVSIELLIIACSAGGMMLFMDLLSSLKEDVGFAVLVIVHRNEKYASSLEQMAQHKC
VLRVKSAEEKETLQAGTVYFAPAGYHLLIEKDRSISLDASEPVHYCRPSIDVSMQSAAEV
YKKSLVAILLSGANKDGAEGLRAVYKYGGKTLVQDPSAALVDVMPRAAIETGAVTAVLLD
EQLKAYCKSLS
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaataaagaagttagcattgaattgttaatcatcgcttgttcagcgggaggaatg
atgctttttatggatttgttgtctagcttgaaggaagatgtcggctttgcggtgttggtc
attgttcaccgaaacgaaaagtatgcaagctcgttggaacaaatggcacagcataaatgt
gtacttcgggtgaaatcggcagaagaaaaagaaacattacaagcaggtacagtttatttt
gcgccggcaggatatcacctattaattgaaaaagatcgcagtatatctttagacgcatca
gaaccggtccattactgtaggccgtctattgatgtcagcatgcaaagtgccgccgaagtt
tataaaaaatcactggtggcaatcctattgtcaggagccaataaggacggtgccgaaggc
ctacgagctgtttacaagtatggcggcaagacccttgtacaggatccgagtgccgcattg
gttgatgtaatgccgcgggcggccattgaaacaggtgctgttaccgcagttcttttggac
gaacaattgaaagcatattgtaagagccttagttga

DBGET integrated database retrieval system