KEGG   Sphingobacterium sp. 21: Sph21_2972Help
Entry
Sph21_2972        CDS       T01450                                 

Definition
dihydrofolate reductase subunit
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
shg  Sphingobacterium sp. 21
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:shg00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:shg00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3706996..3707493)
Genome map
AA seq 165 aa AA seqDB search
MITSIIVAASKNNAIGKNNELLWHMPADLKFFRKTTSGHTVIMGRKTFESVGEALPKRRN
IVITRQANFQADNIEVVNSLEEALAACKHEKEEVFIVGGAQIYEQAMSLTDRIYLTRINH
DFQDADTFFPEINDEEWQLEEVEHHESDEKNPYDYSFYLYSKVKN
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgattacatccattattgttgcagcatcaaaaaataacgcaatcggaaaaaataatgag
cttctttggcacatgcccgctgatttaaagtttttccgtaaaactacgtcgggccatacc
gtcatcatgggaagaaaaaccttcgaatctgtcggggaagcccttcccaagcgccgtaat
attgttattactcgtcaagcaaacttccaggctgacaatatcgaagtagtaaactcactt
gaagaagccttggctgcatgcaaacatgaaaaggaagaggtattcatcgtaggtggcgct
caaatatatgagcaggcgatgtcgctaaccgataggatttaccttactcggattaaccac
gactttcaagacgcggacactttttttcccgaaataaatgatgaagaatggcaattggag
gaagtcgaacatcatgaaagtgatgaaaagaatccgtacgattacagtttttatctatat
tctaaagtcaaaaactag

DBGET integrated database retrieval system