KEGG   Sphingobacterium sp. 21: Sph21_2972Help
Entry
Sph21_2972        CDS       T01450                                 

Definition
dihydrofolate reductase subunit
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
shg  Sphingobacterium sp. 21
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:shg00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Sph21_2972
   00670 One carbon pool by folate
    Sph21_2972
Enzymes [BR:shg01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Sph21_2972
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3706996..3707493)
Genome map
AA seq 165 aa AA seqDB search
MITSIIVAASKNNAIGKNNELLWHMPADLKFFRKTTSGHTVIMGRKTFESVGEALPKRRN
IVITRQANFQADNIEVVNSLEEALAACKHEKEEVFIVGGAQIYEQAMSLTDRIYLTRINH
DFQDADTFFPEINDEEWQLEEVEHHESDEKNPYDYSFYLYSKVKN
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgattacatccattattgttgcagcatcaaaaaataacgcaatcggaaaaaataatgag
cttctttggcacatgcccgctgatttaaagtttttccgtaaaactacgtcgggccatacc
gtcatcatgggaagaaaaaccttcgaatctgtcggggaagcccttcccaagcgccgtaat
attgttattactcgtcaagcaaacttccaggctgacaatatcgaagtagtaaactcactt
gaagaagccttggctgcatgcaaacatgaaaaggaagaggtattcatcgtaggtggcgct
caaatatatgagcaggcgatgtcgctaaccgataggatttaccttactcggattaaccac
gactttcaagacgcggacactttttttcccgaaataaatgatgaagaatggcaattggag
gaagtcgaacatcatgaaagtgatgaaaagaatccgtacgattacagtttttatctatat
tctaaagtcaaaaactag

DBGET integrated database retrieval system