KEGG   Sphingobacterium sp. 21: Sph21_3045Help
Entry
Sph21_3045        CDS       T01450                                 

Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
shg  Sphingobacterium sp. 21
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:shg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sph21_3045
   01230 Biosynthesis of amino acids
    Sph21_3045
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sph21_3045
   00051 Fructose and mannose metabolism
    Sph21_3045
   00562 Inositol phosphate metabolism
    Sph21_3045
Enzymes [BR:shg01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Sph21_3045
Exosome [BR:shg04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Sph21_3045
  Exosomal proteins of bladder cancer cells
   Sph21_3045
  Exosomal proteins of melanoma cells
   Sph21_3045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3785189..3785953
Genome map
AA seq 254 aa AA seqDB search
MRKKIVAGNWKMNMDYQEGISLFSEVANMVKDEVIGNQQIIVCSPFIHLHSIASLAKESE
NVSVGAQNIHQEDAGAYTGEISAKQVRSTGAEYVILGHSERRAYFGESDELLAQKVNIAL
THGLIPIFCIGETREERESGDFFDVIKTQLEKGVFHLSASDFSKIILAYEPVWAIGTGLT
ASPEQAQEVHAFIRKQIEAKYGAAVADETSVLYGGSCNPKNAPDLFSQPDIDGGLIGGAS
LKSRDFTDIVKVFN
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgcgaaaaaaaattgttgccggtaattggaagatgaacatggattaccaagaaggaata
agcctgttttcagaagtggctaacatggtaaaagatgaggttattggtaatcagcaaata
attgtttgcagtccttttatccatttacatagtattgcttctttagcaaaagagagtgaa
aatgtgtctgtgggtgctcagaatatacatcaggaagatgcaggtgcatacacaggggaa
atatcagcaaagcaagtacgctcgacgggcgcggagtatgtaatattagggcattctgaa
agaagggcttatttcggcgaatctgacgagttactggcacagaaagtaaatatagcactt
acacatggcctgatcccgattttttgtataggcgaaacaagagaagagcgcgaatccggt
gatttttttgatgttatcaaaacgcaattagagaaaggtgttttccatctgtcggcaagc
gacttttctaaaataatcctagcttatgagccggtttgggcaattggtaccggattgact
gcaagcccggagcaagcacaggaagtacacgctttcattagaaagcagattgaagcaaaa
tatggtgcagctgtagcggatgaaaccagtgtgctatacgggggaagctgtaatcccaaa
aatgctccggatttattttcacaacctgacatcgatggtggcttaattggcggtgcctca
ttaaaatcaagagactttactgatatagtaaaggtttttaactaa

DBGET integrated database retrieval system