KEGG   Sphingobacterium sp. 21: Sph21_3097Help
Entry
Sph21_3097        CDS       T01450                                 

Definition
recombination protein recR
Orthology
K06187  
recombination protein RecR
Organism
shg  Sphingobacterium sp. 21
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:shg00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Sph21_3097
DNA repair and recombination proteins [BR:shg03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Sph21_3097
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3841737..3842351
Genome map
AA seq 204 aa AA seqDB search
MNFSSKLLENAVNEFSRLPGIGQKTALRLVLHLLNQPADDVTKFSDALTKLKSEICYCAV
CHNIADEAICEICNAPKRDKGLICVVEDTRDVMAIENTNQFNGVYHVLGGLISPMDGVGP
SDLSIDSLINRLRENDVHEIILALSATMEGDTTIFYLYKKLKDFNVQISTIARGISFGGE
LEYVDEVTLGRSIVTRVPYERSIA
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgaacttttcttctaagctattagagaacgcggttaatgaattcagtcgtttacctggt
ataggacaaaagacagctttgcgtttggtattgcacctgctaaatcaacccgccgatgat
gttactaaatttagtgacgcgttaactaaattgaaatcagaaatatgctattgcgctgtt
tgtcataatatcgctgacgaagcgatctgtgaaatttgcaacgcgcccaaaagggataag
ggattgatttgcgtggttgaagatacgcgagacgtaatggcaatcgaaaatacgaatcaa
tttaacggagtgtatcatgttttgggagggctaatctcaccaatggatggagttgggcct
tccgatttgagtattgatagtctgataaaccgtttacgtgaaaatgatgtccatgaaatc
atcctagcgctgagtgcaacaatggaaggggacacgacgattttttacctctataaaaag
ttgaaggattttaatgttcaaattagcacaatagcacggggaatatccttcggcggtgaa
ttggaatatgttgatgaagttacactgggtcgatccatcgttaccagagtaccctatgaa
cgcagtatagcgtaa

DBGET integrated database retrieval system