KEGG   Sphingobacterium sp. 21: Sph21_3102Help
Entry
Sph21_3102        CDS       T01450                                 

Definition
(RefSeq) tryptophan synthase subunit beta
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
shg  Sphingobacterium sp. 21
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:shg00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Sph21_3102
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sph21_3102
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Sph21_3102
Enzymes [BR:shg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Sph21_3102
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3845300..3846484
Genome map
AA seq 394 aa AA seqDB search
MSSYQVNEKGYYGDFGGAYIPEMMFPNIEELRLRYLEIMNEDGFKKEFEQLLKDYVGRPS
PLYLAQRLSEKYSANIFLKREDLNHTGAHKVNNTIGQILLAKRLGKKRIIAETGAGQHGV
ATATVCALMGIECVVYMGEIDINRQAPNVARMKMMGAEVRSATSGSKTLKDATNEAMRDW
INNPVDTHYIIGSVVGPHPYPDMVARFQAVISAETRSQLLEKTGRETPDYAIACVGGGSN
AMGMFYHFLDDEQVQLIAAEAAGKGVNSGHSAATSVLGKEGVLHGSRTILMQTSDGQVIE
PYSISAGLDYPGIGPQHAFLHKIGRAKYVSITDDEAMQAGLLLTRLEGIIPAIESAHALA
QLEKMSFKPSDNVVVCLSGRGDKDLDNYMKYFNF
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgagtagttatcaggtcaatgaaaaaggatattatggggatttcgggggggcgtacatc
ccggaaatgatgttcccgaatatagaggagctacggcttcgttatttggaaattatgaac
gaagatggcttcaaaaaagaattcgagcagctgctgaaagattacgttggaagaccttct
ccgctttatttggctcagcggctttctgaaaaatacagtgccaatatctttttgaagaga
gaagatttgaaccatacaggtgctcataaagtaaataataccatcggacagattttgctg
gcaaagcgtttaggaaagaaacgcatcatcgctgaaaccggagcgggtcagcatggtgtt
gccaccgccacggtatgtgcactgatgggaattgagtgcgtggtttatatgggcgaaata
gatatcaataggcaagcgcctaatgtagcccgcatgaaaatgatgggagcagaagtccgt
tccgcaacgtcaggaagtaaaaccttgaaggacgctacaaatgaagctatgcgcgattgg
attaataacccggtagacacgcactatatcattggctctgtagtaggcccacatccttat
cctgatatggttgcaagatttcaagcggtcatctctgccgaaactcgtagccaactctta
gaaaaaaccggtcgggaaacacctgattatgcgattgcctgtgtaggtggaggaagtaat
gcaatgggaatgttctaccattttttagacgatgagcaggtacagttgattgccgcagag
gctgccgggaaaggggtaaatagcggccactcggcagcaacttccgtgcttggaaaagaa
ggagttttacacggtagtcgaactattttgatgcagactagtgatgggcaagtgattgaa
ccttactctatttccgctggcttagactatccgggtattggtcctcagcatgcattttta
cataaaatcggccgtgcaaaatatgtgagcataacggatgatgaagcgatgcaagcggga
ctcttattaaccagattagaagggattattccagccattgaaagtgctcatgctttggca
cagttggaaaaaatgtcatttaaaccttcggataatgtagttgtatgcctgtcgggtcgc
ggagataaagatttggacaattatatgaaatatttcaatttttag

DBGET integrated database retrieval system