KEGG   Sphingobacterium sp. 21: Sph21_3103Help
Entry
Sph21_3103        CDS       T01450                                 

Definition
tryptophan synthase subunit alpha
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
shg  Sphingobacterium sp. 21
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:shg00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Sph21_3103
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sph21_3103
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Sph21_3103
Enzymes [BR:shg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Sph21_3103
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3846508..3847293
Genome map
AA seq 261 aa AA seqDB search
MNRIKQLFDNKGDKKLLSIYYTAGYPHIDSTIALAKILEASGVDFLEIGFPYSDPVADGP
VIQHSSEEALKNGMSLDLLFNQLKELRKEVQIPVLLMGYVNPMLQYGVERFCRACAEAGV
DGVIVPDLPMYEYEELYQEVFKKYNISNIFLITPQTSEERIRKIDELSTGFIYMVSSYAT
TGKNLVVSEQTAHYFQRVDALNLRNPLVVGFGITDQASFDHALQYADAAIVGSAFVRLLS
QKDYLEQIPSFIGGIKGNVAV
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgaacagaataaaacaattatttgataacaagggcgataaaaaattgctttctatttat
tatactgccggttatccgcatatagatagtaccattgcgttagctaaaatattggaagca
tccggtgttgattttttagagatcggtttcccgtattctgatccggtggctgatggtccc
gtaattcagcacagttcggaagaagctttaaagaatggtatgtcacttgatcttttgttc
aaccaattaaaagagttaaggaaagaggtacagattccggtattgttaatgggatatgta
aatccaatgttgcagtatggagtggagaggttttgtcgggcttgcgcggaagcgggtgtc
gatggggttattgttcccgatttaccaatgtatgaatacgaagagctttatcaagaagtt
tttaagaaatataatattagtaatatcttcttgattacaccacaaacctcggaagagcgt
attagaaaaatcgatgaattaagcacgggcttcatctacatggtatcttcatatgccact
acaggtaaaaatcttgtagtatctgaacaaacggcgcattattttcaacgcgtcgacgcc
ttgaatcttcgcaatcccttggttgttggctttggcattactgatcaggcaagttttgat
catgcattacagtatgcagacgcggccatcgtgggcagtgcttttgttcgtttgctcagt
caaaaggattatttagaacagattccttcatttataggaggtataaagggaaatgttgct
gtatag

DBGET integrated database retrieval system