KEGG   Sphingobacterium sp. 21: Sph21_3103Help
Entry
Sph21_3103        CDS       T01450                                 

Definition
(RefSeq) tryptophan synthase subunit alpha
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
shg  Sphingobacterium sp. 21
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:shg00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Sph21_3103
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sph21_3103
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Sph21_3103
Enzymes [BR:shg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Sph21_3103
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3846508..3847293
Genome map
AA seq 261 aa AA seqDB search
MNRIKQLFDNKGDKKLLSIYYTAGYPHIDSTIALAKILEASGVDFLEIGFPYSDPVADGP
VIQHSSEEALKNGMSLDLLFNQLKELRKEVQIPVLLMGYVNPMLQYGVERFCRACAEAGV
DGVIVPDLPMYEYEELYQEVFKKYNISNIFLITPQTSEERIRKIDELSTGFIYMVSSYAT
TGKNLVVSEQTAHYFQRVDALNLRNPLVVGFGITDQASFDHALQYADAAIVGSAFVRLLS
QKDYLEQIPSFIGGIKGNVAV
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgaacagaataaaacaattatttgataacaagggcgataaaaaattgctttctatttat
tatactgccggttatccgcatatagatagtaccattgcgttagctaaaatattggaagca
tccggtgttgattttttagagatcggtttcccgtattctgatccggtggctgatggtccc
gtaattcagcacagttcggaagaagctttaaagaatggtatgtcacttgatcttttgttc
aaccaattaaaagagttaaggaaagaggtacagattccggtattgttaatgggatatgta
aatccaatgttgcagtatggagtggagaggttttgtcgggcttgcgcggaagcgggtgtc
gatggggttattgttcccgatttaccaatgtatgaatacgaagagctttatcaagaagtt
tttaagaaatataatattagtaatatcttcttgattacaccacaaacctcggaagagcgt
attagaaaaatcgatgaattaagcacgggcttcatctacatggtatcttcatatgccact
acaggtaaaaatcttgtagtatctgaacaaacggcgcattattttcaacgcgtcgacgcc
ttgaatcttcgcaatcccttggttgttggctttggcattactgatcaggcaagttttgat
catgcattacagtatgcagacgcggccatcgtgggcagtgcttttgttcgtttgctcagt
caaaaggattatttagaacagattccttcatttataggaggtataaagggaaatgttgct
gtatag

DBGET integrated database retrieval system