KEGG   Sphingobacterium sp. 21: Sph21_3307Help
Entry
Sph21_3307        CDS       T01450                                 

Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
shg  Sphingobacterium sp. 21
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:shg00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Sph21_3307
Enzymes [BR:shg01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Sph21_3307
Peptidases [BR:shg01002]
 Cysteine Peptidases
  Family C44
   Sph21_3307
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4095278..4096963
Genome map
AA seq 561 aa AA seqDB search
MCGIIGAFDLKVKSQDLRAQVLEMSKKIRHRGPDWSGIFSSDKAILAHERLAIVDPKSGT
QPLYSEDGTVVLAVNGEIYNHRLLRDQLPNYNFSTNSDCEVILALYKEKGVDFLEDLNGI
FAFALYDTEKDVYLIARDHIGIIPFYMGWDKSGNFYVSSELKALEGICNRIQEFKPGHYI
YSAQGQELQRWYRRDWESYESVANNESDIAALRKGLEDAVHRQMMSDVPYGVLLSGGLDS
SIIAAITKKFASKRIESDDKENAWYPSLHSFAVGLKGSPDLAAAQKAAEHIGTIHHEIHF
TIQEGLDAIRDVIYHLETYDVTTIRASTPMYLLARVIKSMGIKMVLSGEGSDELFGGYLY
FHKAPNAKEFHEETVRKLGKLHLYDCLRANKSLAAWGIEGRVPFLDKEFMDIAMRLNPAD
KMAGNGKMEKWILRKAFEDYLPESIAWRQKEQFSDGVGYSWIDTLKEQAMNAVSDEELAN
AKYRFPINPPMSKEEYFYRSIFSEHFPSDSAAACVPSVKSVACSTPEALAWDASFQNLND
PSGRAVSSVHNESYDKEKAAV
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggaattattggtgcatttgacctaaaagtaaagtcgcaggacttgcgtgcccaa
gtgttggagatgtcgaagaagattcgccatcgggggcctgattggtcaggcatattcagc
tcagacaaagcgatattagcccatgagcgattagccatcgtagatccaaaatcaggaacg
cagcctttgtatagtgaagacggaacagttgttcttgccgttaatggtgaaatctataat
caccgtttacttcgcgatcagcttccaaattacaatttttccacaaattctgactgtgaa
gttatcttagcgctctataaagaaaagggtgttgatttcttagaagatctaaatggtatt
tttgcctttgctttgtatgatacagagaaagatgtctatttgatagcacgagatcatatc
ggtatcatcccgttttatatgggttgggataaaagcggcaatttctacgtgtcttccgag
ctgaaggccttagaaggtatttgtaaccgcatacaggagtttaaacctggtcattatatt
tacagtgcgcagggacaagaattacaacgttggtatagaagggattgggaaagttatgaa
agcgttgcaaataatgaatcggatatcgcggcgttgcgaaaaggattggaagatgccgtt
catcggcagatgatgtccgacgtaccttatggcgtcttattgtctggcggtttagattca
tccattatagcggctatcactaaaaaatttgcgtccaagcgaattgagtcggacgacaag
gagaatgcctggtatccttcgttgcattcctttgcggtgggattaaaaggttctccggat
ctagcggctgcacaaaaagcggctgagcatatcggtacaattcatcacgaaattcatttt
actatacaagaaggcttggatgccataagagacgttatctatcatctggaaacttatgat
gtaaccacgatcagggcgtctactcccatgtacttattggcacgggtgatcaagtcaatg
ggcattaaaatggtattaagtggagagggatctgacgagctttttggaggttatttgtat
tttcataaagcaccgaatgcaaaagaatttcacgaggaaacagtccgtaagttaggtaaa
cttcatttatacgattgccttcgcgccaataaatcactagcggcatggggaattgaagga
cgtgtacctttccttgacaaagagtttatggacattgctatgcgcctaaatccagcggat
aaaatggcaggaaatggcaagatggagaaatggatattgcgaaaagctttcgaggattat
ttgccggaaagtattgcatggcgccaaaaagagcaattctctgatggggtggggtatagc
tggatcgatacgttgaaagaacaagcaatgaatgcggtgtctgacgaagaattagcgaat
gctaaatatcgttttccaataaacccaccgatgtctaaagaagaatatttttatagaagt
attttcagtgagcattttccttccgattcggcggccgcatgcgtgccatcggtgaagtcg
gtagcttgtagtacgccggaggcgttggcttgggatgcctcattccaaaacttgaacgat
ccatcgggtagggcggtgtcaagcgtacataacgaaagttatgacaaagaaaaggcggct
gtttaa

DBGET integrated database retrieval system