KEGG   Sphingobacterium sp. 21: Sph21_3338Help
Entry
Sph21_3338        CDS       T01450                                 

Definition
(GenBank) Succinyl-CoA ligase (ADP-forming) subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
shg  Sphingobacterium sp. 21
Pathway
shg00020  Citrate cycle (TCA cycle)
shg00640  Propanoate metabolism
shg00660  C5-Branched dibasic acid metabolism
shg01100  Metabolic pathways
shg01110  Biosynthesis of secondary metabolites
shg01120  Microbial metabolism in diverse environments
shg01130  Biosynthesis of antibiotics
shg01200  Carbon metabolism
Module
shg_M00009  Citrate cycle (TCA cycle, Krebs cycle)
shg_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:shg00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Sph21_3338
   00640 Propanoate metabolism
    Sph21_3338
   00660 C5-Branched dibasic acid metabolism
    Sph21_3338
Enzymes [BR:shg01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Sph21_3338
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: ADZ79879
UniProt: F4C5S0
Position
complement(4126384..4127574)
Genome map
AA seq 396 aa AA seqDB search
MNIHEYQGKAILKSFGVRIQEGIVADNPEQAVEAAKKLKQDYNSDWVVVKAQIHAGGRGK
GGGVKLAKNIDEVREKAKEIIGMQLVTPQTGPAGKKVNKVLIAQDVYYPGASETKEFYMS
VLLDRSRGRNIIMYSTEGGMDIEEVAEKTPHLIQKEEIDPSIGLQGFQARKIAFNLGLSG
AAFKDMTKFVAALYKAYEATDSSQFEINPVLKTSDDKILAVDAKVNLDENALYRHADYAE
LRDLSEEDPTEVEAGRSNLNYVKLDGNVGCMVNGAGLAMATMDIIKIAGGEPANFLDVGG
TANAETVKAGFNIILKDPNVKAILINIFGGIVRCDRVAQGVIDAYQEIGNIPVPIIVRLQ
GTNAEEAKKLIDESGLEVFSAIQLKEAADLVTKVLS
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgaacattcacgaatatcaaggtaaagctatactgaagagtttcggagttcgcattcag
gaaggtatcgttgccgataaccctgaacaagcggtagaagctgcgaaaaagttaaaacaa
gattataattctgattgggttgtggtaaaagcacagatccacgcaggaggccgcggaaag
ggcggcggtgttaaacttgcaaagaatatcgatgaggttagagaaaaagctaaagaaatc
atcggtatgcaactagtaactcctcaaactggtcctgccggaaaaaaggtaaataaagta
cttatcgcacaagatgtttactatccgggagctagcgaaaccaaggaattctatatgagt
gttttgttggatagatcacgcggacgcaacattatcatgtattctactgaaggtggtatg
gatattgaggaagtagctgaaaagacacctcatcttattcaaaaagaagaaatagaccct
tccattggacttcaaggatttcaagcaagaaaaattgctttcaatctgggactaagcggt
gcggcttttaaagatatgactaaatttgtagcagctctttacaaagcttacgaagcaaca
gactcttctcaattcgaaatcaacccggttttaaaaacttccgatgacaaaatattagca
gttgatgctaaagtcaatttggatgaaaatgcattataccgtcacgctgattatgctgaa
ttgcgtgatttatcagaagaagatccgacagaagtagaagccggacgctccaatttgaat
tacgttaaactagatggaaatgtcggttgtatggtaaacggtgccggtttggcaatggct
accatggatattattaaaattgccggtggagaacctgcgaactttttagatgttggtggt
actgccaacgctgaaacagtcaaagccggattcaatattattttaaaagatcctaatgta
aaggctattctcatcaatattttcggaggcatcgttcgttgcgaccgtgtagctcagggc
gtcattgatgcttatcaagaaattggcaatattcctgtgcctattattgttcgtttacag
ggcacgaatgcagaagaagctaaaaaacttattgacgaatcaggacttgaggtattctca
gcaattcagctgaaggaagcggctgatttagtaactaaagtactttcttag

DBGET integrated database retrieval system