KEGG   Sphingobacterium sp. 21: Sph21_3894Help
Entry
Sph21_3894        CDS       T01450                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
shg  Sphingobacterium sp. 21
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:shg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sph21_3894
   01230 Biosynthesis of amino acids
    Sph21_3894
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sph21_3894
   00030 Pentose phosphate pathway
    Sph21_3894
   00051 Fructose and mannose metabolism
    Sph21_3894
   00052 Galactose metabolism
    Sph21_3894
  Energy metabolism
   00680 Methane metabolism
    Sph21_3894
Enzymes [BR:shg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Sph21_3894
Protein phosphatases and associated proteins [BR:shg01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Sph21_3894
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4719275..4720261)
Genome map
AA seq 328 aa AA seqDB search
MDNSIKRIGVFTSGGDAPGMNACIRAVVRTAIYEGKKVSGILHGYQGMIDGNIIDMNSRS
VSNILQLGGTILKTARCLDFRTPEGRKKAYDNIRAQGVDALVAIGGDGTFTGAEVFSREY
DIPVVGVPGTIDNDLYGSDFTLGYDTANNTVIDAIDKIRDTAASHDRLFFIEVMGRDSGC
IALNCGIAGGAEAILLPEKETGIDELIQKLENAAKDKKTSTIVIVAEGDKNGGAYNVAKR
VQEKFDFYDTKVTILGHLQRGGSPSSFDRVLASRLGFAAVKRLLRGETRVMVGLRGNDIV
TTPLEVALRSKEFKLADDMIEMMNVLAI
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
gtggacaattcaatcaaacgtataggcgtatttacttcagggggagatgctccagggatg
aacgcatgtattcgggcggtagttcgtaccgccatttatgaaggcaaaaaagtaagtggt
atattgcatggatatcaaggaatgatcgatgggaatatcatcgatatgaatagtcgttcg
gtcagtaatattcttcaactgggaggtactattttaaaaacagcacgttgcttggacttt
agaacacctgaaggacgtaaaaaggcctatgataatataagagcacagggagttgatgct
ttggtagctattggaggagatggaacttttaccggggccgaagtgttctccagggagtat
gatattccggttgttggcgtaccaggtactatagacaatgatttatacggatccgacttt
accttgggatatgatacagctaacaacacggtgattgatgcaatagataagatccgtgat
acagcggcttcccatgatcgtttgttttttattgaggtaatgggacgcgattcgggctgc
attgccttaaactgcggtattgcaggaggtgctgaggccattttgttacctgagaaggaa
acaggtattgacgagcttattcaaaaattggaaaatgctgcgaaagacaagaaaacttct
accattgtaattgttgctgaaggtgataaaaatggaggggcatacaacgtagctaaaagg
gttcaggaaaagttcgatttttatgataccaaagttaccatattaggccatttgcaaagg
ggcggctctccgagcagctttgaccgtgtattggccagccggctgggctttgcagccgtt
aaaaggctattaagaggtgagacaagggtaatggttggtttgcggggaaatgatattgtg
acaacccctttggaggttgcgctccgaagcaaggaatttaaattagccgatgatatgatc
gaaatgatgaatgttttagcgatttag

DBGET integrated database retrieval system