KEGG   Sphingobacterium sp. 21: Sph21_3963Help
Entry
Sph21_3963        CDS       T01450                                 

Definition
xylose isomerase
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
shg  Sphingobacterium sp. 21
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:shg00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Sph21_3963
   00051 Fructose and mannose metabolism
    Sph21_3963
Enzymes [BR:shg01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     Sph21_3963
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4810225..4811553)
Genome map
AA seq 442 aa AA seqDB search
MSIIIGEREYFKGIGQIKYEGPESDNPLAYRWYDPNRVVGGKTMKEHLRFAVAYWHSFNG
TGSDPFGGQTHVFPWDEHADVIQRAKDKMDAAFEFFTKIDMPYYCFHDVDVVDYGDNVVE
NEERLQKLVAYAKEKQQASGVKLLWGTANLFSHKRYMNGAATNPDFHVVAHAGAQIKAAL
DATIALGGENYVFWGGREGYMTLLNTDMKREQEHLAKMLHIAKDYARSQGFKGTFFIEPK
PCEPTKHQYDYDAATVIGFLRQYDLLNDFKLNLEVNHATLAGHTFQHELQVAADAGLLGS
IDANRGDYQNGWDTDQFPNNINELVESLLIILEAGGFAGGGINFDAKIRRNSTDPADLFY
AHIGGADTFARALLVADKILKNSDYTKIRRERYLSFDSGDGKAYEEGKLSLADLRNLAIS
LGEPKAISGKQEYLENLINRYI
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgtcaattattattggagaacgcgagtattttaaaggaatcggacaaataaagtatgaa
ggtccggaaagtgataacccattagcttatcgttggtacgatcctaaccgggtagtagga
ggtaaaaccatgaaagagcatcttcgctttgctgtagcctattggcactcattcaacgga
acgggttcggatccttttggtggtcaaacgcatgtgtttccctgggatgagcacgcagac
gtaattcagcgggcaaaagacaaaatggatgccgcatttgagttctttaccaaaattgac
atgccatactattgcttccatgatgtagatgtagtggattatggagataatgttgtggaa
aatgaagaacgtctgcaaaaattagtcgcttatgcaaaagaaaaacaacaggctagtggc
gtaaaattgctatggggaacggctaatctcttcagtcataaacgctatatgaacggcgct
gcaacgaatcctgattttcatgttgtggcgcacgcgggcgcacaaatcaaagcggcactc
gacgcaacaatcgctttaggtggtgaaaattatgtcttctggggtggtagagaaggttat
atgaccttgctgaacacggatatgaagagggaacaggagcatttggcgaagatgttacat
atagcaaaagactatgcacgttcgcaaggtttcaagggcaccttcttcattgaacccaaa
ccttgtgaacctacaaaacatcaatatgactacgatgccgcgactgttataggctttcta
cgtcaatatgacttgttaaatgattttaagctaaatctggaagtgaaccacgctacctta
gcaggacatactttccagcatgagctacaagtagctgcggatgcgggattattaggttcc
attgacgctaaccgtggcgattaccaaaatggatgggatacggatcagtttccgaataat
atcaacgaactggtggaatctctgttgatcattttagaggcgggtggttttgctggaggc
ggtattaactttgacgctaaaattagacgtaactcaaccgatccggccgatttattctac
gcacatatcggtggcgcagatacttttgcacgtgctttattagtggcagacaaaattttg
aaaaactctgactatactaaaataagaagagagcgctacctttctttcgatagcggtgat
ggcaaagcctatgaggaaggaaagctatcgttagcggatcttcgcaatctggcgatttcg
cttggtgaaccgaaagcaatcagtggtaaacaagaatatttggagaatctgattaatcgg
tatatttaa

DBGET integrated database retrieval system