KEGG   Sphingobacterium sp. 21: Sph21_4066Help
Entry
Sph21_4066        CDS       T01450                                 

Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
shg  Sphingobacterium sp. 21
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:shg00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Sph21_4066
  Lipid metabolism
   00561 Glycerolipid metabolism
    Sph21_4066
   00600 Sphingolipid metabolism
    Sph21_4066
Enzymes [BR:shg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Sph21_4066
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4921690..4923915)
Genome map
AA seq 741 aa AA seqDB search
MQRTIVFMKHCCFVLIAICCYLIAGAQQKELTNQVKEQLILEGSEQAIVLQVEINGDLNM
VYLGPKLLHSSDYRRLASQYKQADDYTGMYRAAYTGSGSRNLLEPAISVRHADGNQSLDL
KYLNHEFITVNHNIGELRVLLKDALYPFEVDLHYRIYQKENVIEQWATIRHHEKGAVELV
KYSSANLNLKADNFWLKHYHGDWIKEMQPEEEKLTHGIKTIDSKLGTRANLFQHSSFLLS
FNGPAKEDEGSVLIGGLAWSGNFKIDFEKDPQDNLRILAGINNYASTYILQKNEEFITPK
FVYTISDQGIGNASRNLHNWARRYQLLDGGGSRLTLLNNWEATYFDFNEDKLSSLLKDTK
KLGVDLFLLDDGWFGNKYPRNSDTAALGDWEENREKLPNGLVSLVKEAASNGVKFGIWVE
PEMVSPKSELYEKHPDWVVKQEGRPEYYFRNQLVLDLSNPKVQDFVFKTLDDLFVKNPGL
AYVKWDCNAVIYNAYSPYLKSQGNFYVDYVKGLYAVLERIRAKYPRIPMMLCSGGGGRVD
YGALRYFTEYWPSDNTDPLERIFMQYEYSFFYPALASANHVTDWGDQPIKFKVDVAMMGK
LGFDIVVSKLPKEDLAFCQQALKTYDELKPIIWQGDQFRLANPREKDYASILYVNENRDS
GVIFNYLVNYRQNTGTPAPIKFKGLDPVKSYRLEEINLYNGESSLINPGETYTGDFLMKV
GFNPYLSSKRKSVVLKLTAVS
NT seq 2226 nt NT seq  +upstreamnt  +downstreamnt
atgcaaagaacaatcgtatttatgaaacactgctgtttcgtcttaattgccatctgctgt
tatcttattgcaggagcgcagcaaaaagagcttaccaaccaagtaaaagagcaacttatt
ttagagggtagcgaacaagccattgttttacaagtggaaatcaatggcgatctcaatatg
gtttatttgggccctaaattgctacattcttctgactaccgccgactggcttctcaatat
aaacaagctgacgattataccgggatgtaccgcgcggcctatacagggtcgggaagtcgt
aacttgctggaacctgcgatcagtgtgcgacacgcagacggtaatcaatcgctggattta
aaatatctgaaccatgaatttatcactgtaaaccataacatcggtgagttacgggtgctt
ctaaaagatgctctatatccttttgaagttgatttacattatcggatctatcaaaaagaa
aatgttatcgagcaatgggctaccattcgtcatcatgagaagggagctgtggagttggtt
aagtattcgtccgccaatttaaacttaaaagcggacaatttttggttaaagcattatcac
ggcgattggatcaaggaaatgcagcccgaggaagagaagttaacgcacggaataaaaacg
attgacagcaaattgggaacgcgagcaaacctttttcagcattcttcctttttgctgtct
tttaatggtcctgccaaagaagatgaggggtctgtgcttataggcggtttagcatggagc
ggtaatttcaaaattgatttcgagaaggatccgcaagacaacctacgtatactagccgga
ataaacaattacgcctctacttatatactgcaaaaaaatgaagaattcataacgcctaag
tttgtctatacgatttctgatcagggcatagggaatgcgagtagaaatcttcataattgg
gcacggaggtatcaattgcttgatggcggaggcagtagattaaccttattgaacaattgg
gaagccacttatttcgattttaatgaagacaaactttcttctctgctaaaagatacaaaa
aagttaggggttgatttgtttcttttagatgatggctggttcggaaataaatatccaaga
aacagcgatacagcggctttaggcgattgggaagagaatagggagaaattacccaatggc
cttgtttctttagtaaaggaggctgcgtccaatggggttaaatttggtatttgggtggaa
cctgagatggtaagtcctaaaagcgagttatatgaaaaacatccggattgggtggtaaag
caagagggacgtcctgaatattattttagaaatcagttggtgttggacttgtcaaaccct
aaagtacaggattttgttttcaagacgttggatgatttgtttgtaaaaaatccgggcctc
gcctatgtgaaatgggattgcaatgctgttatttacaacgcctattccccttatctcaaa
agccagggaaatttctatgtagactacgtgaaagggttatatgcggttctggaacggatc
agggccaagtatccaagaataccgatgatgctttgctcggggggaggaggacgggttgat
tacggggcccttcgctatttcactgaatattggccgagtgataatacagaccctttggaa
cgtattttcatgcagtatgaatattcttttttttatccggctttggccagcgctaatcat
gtaactgactggggagaccagcccattaaatttaaggttgacgttgctatgatgggtaaa
ttaggatttgatattgtggtcagtaaactaccaaaagaagatttggcattttgtcagcaa
gcgctgaaaacctacgatgaattaaaaccgattatttggcaaggcgatcaatttcgattg
gcaaaccctcgagaaaaggattatgcttctattctatatgtcaatgaaaatagggattca
ggggtaatatttaattacttggtaaattatcgtcaaaatacaggtacgccggcccccata
aagttcaaaggattagatccggttaaaagctaccggttggaagagataaatctttataac
ggagaatcatctctgattaatcccggggaaacttatacgggcgactttttgatgaaggta
ggttttaacccctatttgtctagtaagcgaaagagcgtcgtgttgaagcttaccgcggtg
tcatag

DBGET integrated database retrieval system