KEGG   Sphingobacterium sp. 21: Sph21_4263Help
Entry
Sph21_4263        CDS       T01450                                 

Definition
carbohydrate binding family protein
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
shg  Sphingobacterium sp. 21
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:shg00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:shg00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:shg00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5133738..5135792
Genome map
AA seq 684 aa AA seqDB search
MQIIKYLYSFSFAALSFFFTTTNVVAQTTADYVVPFGGENELIIHRKSGSFSIKYKSTAI
INEAGISFLANQKKYTNTDYSNYEIQQQQIKDELGKGIQIKLTAKAPGQPTVNHYFYCYP
NREFILTQLEIMDQQLLTSNQLIPLYSEHAQLLHGEDVRTLFVPFDNDTFISYDAKPISL
NAQTSAEIGVVFDNQSRHGLVVGSLNHMNWKTGVKTAGQKASIHELEICAGYSDVKVTRD
SMAHGAISGKTIQSPKIFVGYFSDWRDGLETYAKAGRSVEAPYIKPWAKATPVGWNSWGV
IKEHLSYEQATRVVDFFDKKIPFFRNNDQTAFIDLDSFWDNMVEGGFSGDFSQLKEFVAY
CKKRALEPGVYWAPFTDWGFGGDSNRVAEGGNYKFSDMWTKTTKGYHDLDGGRALDPTHP
GTQARIAYVINKLKECGFKMIKIDFLAHAAAESSGFFDSTISTGMQAYRVGMECLSDHLA
NSMLVYAAISPSLATARYAHMRRIACDAWKSIKDTEYTLNSVNYGWWQTYQYDYIDADHL
VFEQESEGANRARLIAGLITGSVILGDDYSKPAHWQQRIIKWLQSAEIKSIIQSGKAFRP
VEGNTGTKTNPLFIRSDQDGTYLAVFNFDTEATTIHLDTERVGLNPNKTYVFKEVLSGQE
MKLNKQMDIAFEKEGAYLYKISAK
NT seq 2055 nt NT seq  +upstreamnt  +downstreamnt
atgcaaatcataaagtatttatatagcttcagcttcgctgctttatcattcttttttacg
acaacaaatgtggtggctcaaaccacagcagattacgttgtcccgtttggcggagagaat
gaactgattattcatagaaaatcggggtcattctccataaaatataagagcacagctatt
ataaacgaagccggaatttcttttctagccaaccagaagaaatacactaacaccgattac
agtaactacgaaatacaacaacagcaaataaaagacgaattggggaaaggtattcagatt
aaacttaccgcaaaagcaccggggcaaccaacggtcaaccattatttctactgctatcca
aaccgggaatttattttgacgcaattggaaataatggatcaacaattattgacttccaac
cagctcatacccttatatagcgagcatgcacagctcctacacggtgaagatgttagaacg
ctattcgtaccttttgataacgatacatttatctcttacgacgcaaaacctattagcttg
aatgcacaaacaagtgcagaaataggcgttgtgtttgacaatcaatctcgtcacggattg
gttgttggatccttaaaccatatgaactggaaaaccggcgtgaaaactgccggtcaaaaa
gcctctattcatgaactcgaaatatgtgctggttacagcgacgtaaaggtgaccagagat
tccatggcacacggagcaatcagtggcaaaacgatacaatcgccgaaaattttcgttggt
tatttttcggattggcgagatggcctggaaacttacgcaaaagcaggtcgatcggttgaa
gcgccctatattaaaccgtgggccaaagctacacccgttggttggaatagctggggcgtt
atcaaggaacatctcagctacgaacaggcgacccgtgtagttgatttttttgacaaaaaa
attccattctttagaaataatgatcaaaccgcctttatcgatctcgactctttttgggat
aatatggtggagggtggattctccggtgatttttcccaattaaaggaattcgttgcttat
tgcaaaaaaagagcgctggagcccggggtttattgggcaccattcaccgactggggcttt
ggaggagattctaacagggtagcggaggggggtaactataaattttcagacatgtggacg
aaaaccactaaaggttaccacgacctcgatggcggcagagcacttgatcccacccatccc
ggcacacaagcccgaatcgcctatgttattaacaaacttaaggagtgcggatttaagatg
ataaaaatcgacttcctcgcacatgccgcagctgagtccagtggttttttcgatagcaca
ataagcaccggtatgcaggcatatcgagttggaatggaatgtctatcagaccatctagct
aacagcatgttggtatatgcagccatctccccttctttagcaacagcgcgctatgcgcat
atgagacgcatagcctgcgatgcttggaaaagtattaaagatacggaatacacgttaaac
agcgtcaattatggctggtggcagacttatcaatacgattatatcgatgcagatcatttg
gttttcgaacaggagagcgaaggggctaatcgtgcacgcctaatcgctggtttgattaca
ggttcggttattttaggtgatgattattcaaagcctgcgcattggcaacaacggatcata
aaatggctccaaagcgctgaaattaaatcaatcatacaatccgggaaagcctttcgtccg
gtagaagggaacactgggacaaaaaccaatcccctatttatccgctctgaccaggacggt
acctaccttgccgtatttaacttcgacaccgaggctacaactattcatctcgacacggag
cgggttggtttaaaccccaataagacctacgtatttaaagaggtattaagtggccaagaa
atgaaactaaacaagcagatggacatcgcatttgaaaaagaaggtgcttatctttacaaa
atcagtgctaagtaa

DBGET integrated database retrieval system