KEGG   Sphingobacterium sp. 21: Sph21_4278Help
Entry
Sph21_4278        CDS       T01450                                 

Definition
(GenBank) 6-phosphogluconolactonase
  KO
K01057  6-phosphogluconolactonase [EC:3.1.1.31]
Organism
shg  Sphingobacterium sp. 21
Pathway
shg00030  Pentose phosphate pathway
shg01100  Metabolic pathways
shg01110  Biosynthesis of secondary metabolites
shg01120  Microbial metabolism in diverse environments
shg01130  Biosynthesis of antibiotics
shg01200  Carbon metabolism
Module
shg_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
shg_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:shg00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Sph21_4278
Enzymes [BR:shg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.31  6-phosphogluconolactonase
     Sph21_4278
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucosamine_iso
Motif
Other DBs
NCBI-ProteinID: ADZ80801
UniProt: F4C659
Position
5153643..5154362
Genome map
AA seq 239 aa AA seqDB search
MINVFKDIDTLSKSAAEHFVQIAQNAIESSGRFSVALTGGSSPIQLYHLLAEQPYVEQID
WTKVFVFWGDERWVPLTDDKSNAKMAFETLLDHVPIPKNQIFPMWKANTTPEVYALEYEQ
LLQTHFGTNPQFDLILLGMGEDGHTASLFPNTAVLKEKKKWVEAYYLEPQQMYRITLTAP
LINQAKVIAFITYGKGKAKALYEVLHGEPNPSQYPSQLIRPDQGEVYWFVDEAAANRVR
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgattaacgttttcaaagatattgatacactgagcaaaagtgcggctgagcattttgta
caaatcgcccaaaatgcaatcgagtcaagcggtcgcttttccgtagcgctaacgggaggg
agctctcctattcagctctatcacttacttgctgaacagccctatgtagaacaaatcgat
tggacgaaagtatttgttttctggggagatgagcggtgggtaccgttaaccgacgacaag
agcaatgcaaaaatggcatttgaaacgctgttagaccatgttcccattccaaaaaatcaa
attttcccgatgtggaaggcgaatactacaccggaggtttatgcattggaatatgaacaa
ctattacaaacgcattttggtacgaatccacaatttgacctgatattattgggcatggga
gaagatgggcatacggcttctttatttccgaacacggccgttttaaaagagaaaaaaaaa
tgggtcgaggcctactacttggaaccgcaacagatgtatcgcattacattaacagcccct
cttattaatcaagcgaaagttattgcttttattacttacggaaaaggtaaagcaaaagca
ctttatgaagtcttacacggggagcccaatccaagccagtatccatcgcagttgattagg
ccggatcagggtgaggtttactggtttgtagatgaggccgccgcaaatcgagtgagataa

DBGET integrated database retrieval system