KEGG   Sphingobacterium sp. 21: Sph21_4278Help
Entry
Sph21_4278        CDS       T01450                                 

Definition
6-phosphogluconolactonase
Orthology
K01057  
6-phosphogluconolactonase [EC:3.1.1.31]
Organism
shg  Sphingobacterium sp. 21
Pathway
Pentose phosphate pathway
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pentose phosphate pathway (Pentose phosphate cycle)
Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:shg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sph21_4278
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Sph21_4278
Enzymes [BR:shg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.31  6-phosphogluconolactonase
     Sph21_4278
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5153643..5154362
Genome map
AA seq 239 aa AA seqDB search
MINVFKDIDTLSKSAAEHFVQIAQNAIESSGRFSVALTGGSSPIQLYHLLAEQPYVEQID
WTKVFVFWGDERWVPLTDDKSNAKMAFETLLDHVPIPKNQIFPMWKANTTPEVYALEYEQ
LLQTHFGTNPQFDLILLGMGEDGHTASLFPNTAVLKEKKKWVEAYYLEPQQMYRITLTAP
LINQAKVIAFITYGKGKAKALYEVLHGEPNPSQYPSQLIRPDQGEVYWFVDEAAANRVR
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgattaacgttttcaaagatattgatacactgagcaaaagtgcggctgagcattttgta
caaatcgcccaaaatgcaatcgagtcaagcggtcgcttttccgtagcgctaacgggaggg
agctctcctattcagctctatcacttacttgctgaacagccctatgtagaacaaatcgat
tggacgaaagtatttgttttctggggagatgagcggtgggtaccgttaaccgacgacaag
agcaatgcaaaaatggcatttgaaacgctgttagaccatgttcccattccaaaaaatcaa
attttcccgatgtggaaggcgaatactacaccggaggtttatgcattggaatatgaacaa
ctattacaaacgcattttggtacgaatccacaatttgacctgatattattgggcatggga
gaagatgggcatacggcttctttatttccgaacacggccgttttaaaagagaaaaaaaaa
tgggtcgaggcctactacttggaaccgcaacagatgtatcgcattacattaacagcccct
cttattaatcaagcgaaagttattgcttttattacttacggaaaaggtaaagcaaaagca
ctttatgaagtcttacacggggagcccaatccaagccagtatccatcgcagttgattagg
ccggatcagggtgaggtttactggtttgtagatgaggccgccgcaaatcgagtgagataa

DBGET integrated database retrieval system