KEGG   Sphingobacterium sp. 21: Sph21_4288Help
Entry
Sph21_4288        CDS       T01450                                 

Definition
ROK family protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
shg  Sphingobacterium sp. 21
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:shg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sph21_4288
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sph21_4288
   00052 Galactose metabolism
    Sph21_4288
   00500 Starch and sucrose metabolism
    Sph21_4288
   00520 Amino sugar and nucleotide sugar metabolism
    Sph21_4288
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Sph21_4288
   00524 Butirosin and neomycin biosynthesis
    Sph21_4288
Enzymes [BR:shg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Sph21_4288
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5167834..5168754)
Genome map
AA seq 306 aa AA seqDB search
MRNKPYSSIENIVIAADIGGSHITVAPIDISLSQTVSEETFRVRVNSKGTREEILDAWLN
ALETAFSSFDERPDKLALAMPGPFDYENGISFIRGLDKYESLYDINIKEELANTLNLSHK
HVLFRNDAEAFLHGEVATGLVEMNNRVLGLTLGTGMGTAFSHVGKTTDLNLGSMTYETSI
ADDFFTTRWFVKRYEALSGNKVANVEALSELVEKDRAVEVLFEEYADGLSSFLADHIAGL
KIDTLVFGGNISKASRLFLPQFSARLASLGATPTIKMAQQGEQSAMIGAAFLFKEIEGLY
AHKIIA
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgcgaaataagccttattcatctattgagaacattgtcatcgctgcagatattggtggt
tcacatatcacggttgctcctatcgatatttctttgtcacaaacggtttcagaagaaacg
tttcgcgtgcgtgtaaatagtaagggaactcgtgaggaaattttggatgcttggttaaat
gcgttggagacagctttttcctcctttgatgaacgtcctgataaattagccttagcgatg
ccaggtccatttgattatgaaaatggtatttcctttatacgggggttagataaatatgag
agcttatatgatatcaacataaaagaagaattagcaaatacattaaatttatctcataag
cacgttttgtttagaaacgatgcagaagcttttctgcacggtgaagtagcgacgggttta
gtagagatgaataatcgtgttttaggcctcacattaggcacaggcatgggaacagcgttt
agtcatgttggaaagactaccgatttgaacttgggaagtatgacctacgaaacaagtatt
gcagatgatttttttacaacgcgttggtttgtaaaacgttatgaagcattaagcggaaat
aaggttgcaaatgtcgaggcgcttagcgagttggttgaaaaagatcgggcagtggaagta
ctatttgaagaatatgcggacgggttaagcagtttccttgccgatcatattgccggttta
aagattgataccttggtttttggcggcaatatttcaaaagcgagccgactttttttgcct
caattttctgcaaggttagccagtctcggcgctacacctaccatcaaaatggctcaacaa
ggggaacaatcggcaatgatcggagcggcatttttatttaaggaaatcgaaggtttatat
gcacataaaataatagcttaa

DBGET integrated database retrieval system