KEGG   Sphingobacterium sp. 21: Sph21_4465Help
Entry
Sph21_4465        CDS       T01450                                 

Definition
phospholipase A1
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
shg  Sphingobacterium sp. 21
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
Linoleic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:shg00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Sph21_4465
   00565 Ether lipid metabolism
    Sph21_4465
   00590 Arachidonic acid metabolism
    Sph21_4465
   00591 Linoleic acid metabolism
    Sph21_4465
   00592 alpha-Linolenic acid metabolism
    Sph21_4465
Enzymes [BR:shg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     Sph21_4465
    3.1.1.32  phospholipase A1
     Sph21_4465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5357788..5358639
Genome map
AA seq 283 aa AA seqDB search
MMRYQSWQRLWFTGFSVFIIWLCPSLSKAQLIERDSAFTSSEAITGHPGFSIHRDNYFIT
GIPMNQQPTRNNSDIKYQISFKQRLRKTPLPGGLFPYITYSQKAFWDIYRDSKPFDEINF
NPGLALVRPFFLKGHRLAYATLSLEHESNGRDSIYSRSWNFMAFSLRSQLDEHWIVGLRF
WLPMSYKDDNPDLMDYVGYAEANATYRIKPDKWSVDITAKKGKGWNRRGSIQAQLNWRPF
KDENQYLMLQWFQGYGESLIDYREHTSMIRIGFMLKATTLGIY
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgatgcgttatcaatcatggcaaagattatggttcacaggtttttcagtgtttataatt
tggttatgtcccagccttagcaaagcgcaattaattgaacgcgacagtgcatttacttca
tctgaagcaattacaggtcaccccggtttttctatacatcgcgataactatttcatcacg
ggtattccgatgaatcaacaaccaacacgaaataactcggatattaagtatcagattagt
ttcaaacaacgcttacgcaaaacaccgctacccggtggtctatttccttatattacgtac
tcacaaaaggcattttgggatatctatcgcgattctaaaccatttgacgaaattaacttc
aaccctgggcttgccctagtaagacctttttttctaaaagggcatcgtttggcctacgct
acgctatcgctggaacacgaatcaaacgggcgtgattccatttattctcgtagctggaac
ttcatggccttttctttgaggtcgcaactagatgaacactggattgtagggcttcggttc
tggttgcctatgtcttacaaggatgacaacccggatctaatggactatgtgggttacgcc
gaggctaatgctacttatcgaattaaacctgacaagtggtcggtcgatataaccgctaaa
aaaggaaaaggatggaacagaaggggatcaatccaagctcagttgaattggcgacctttc
aaggatgaaaatcaatatcttatgctacaatggtttcagggctatggtgaaagtttgata
gattatcgggaacatacaagcatgatacgcataggctttatgctgaaagcaactacgtta
ggaatctattaa

DBGET integrated database retrieval system