KEGG   Sphingobacterium sp. 21: Sph21_4486Help
Entry
Sph21_4486        CDS       T01450                                 

Definition
fatty acid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
shg  Sphingobacterium sp. 21
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:shg00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Sph21_4486
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Sph21_4486
Enzymes [BR:shg01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     Sph21_4486
Lipid biosynthesis proteins [BR:shg01004]
 Desaturase
  First
   Sph21_4486
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5382078..5383088
Genome map
AA seq 336 aa AA seqDB search
MLLDKVLDPPSYGWTDRDGALSKPTTKQLLREFLKRINIFQSKKNWLPLFSWARVLLLIP
LLFLFIFNYFSVALLVAAFIYSMIIMGTHGTIWHHRYCTHKAYRFKNRFWRVLTQNLTIS
MIPEEIYAISHHVHHAKSDKPGDPYNANGGFLYCFLADVNHQPIAKDLSAEEYKQTVQLM
AHTGVKANCYRKYQKWGSVVHPMRAISACLVNWLVWYGIFYLIGGHALACALFGAAAFWA
IGVRTFNYEGHGKGKDKRKKGYDLNEKDMSINQLWPGFVAGEWHNNHHLYPSSARSGFLK
HQVDLAWYYIKFLHFIGGVITYHDSKASFMKRYNGA
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgttattagataaagtgttagatccgccatcgtatggatggacggatcgggatggggcc
ctcagtaaacctacaaccaagcaattactccgcgagtttttaaaacgtattaatatattt
caatccaaaaaaaattggttacctctatttagctgggctcgcgtacttttactgattccg
ctgctatttctttttatattcaactatttcagcgtcgcattattagttgccgcgtttatt
tacagcatgatcattatgggaacgcacggaacgatctggcaccatcggtattgcacgcac
aaagcctaccgttttaagaatcgattttggcgggtgctaacacaaaacctaacgatcagc
atgattcccgaagaaatttatgccatctcgcaccacgtgcatcacgcgaaatcagacaag
ccgggcgatccttataatgccaatggcggtttcttatattgctttttagcagatgtaaat
catcaacctattgctaaagacctcagtgcagaggaatataagcaaactgtgcaactaatg
gcccacaccggtgtaaaagctaattgctatagaaagtatcagaaatggggatcagttgta
catccaatgcgtgctatctctgcttgcttagtaaattggctggtatggtacggtatattt
tatttaattggcggtcatgcgctggcttgcgcactctttggtgccgcagctttctgggca
ataggcgtgcgaacgtttaattatgaaggacatggaaaaggaaaagataagcgtaaaaaa
ggctatgatttaaacgaaaaagatatgtcaattaatcaattatggccaggttttgttgca
ggggaatggcataataatcatcatttatacccgagcagtgcgcgttcaggctttttaaaa
catcaggtagacttggcttggtattatataaagttcttgcactttatcggtggcgtaatc
acttaccatgattcgaaagcttcttttatgaagcgatataacggggcataa

DBGET integrated database retrieval system