KEGG   Sphingobacterium sp. 21: Sph21_5042Help
Entry
Sph21_5042        CDS       T01450                                 

Definition
cytochrome-c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
shg  Sphingobacterium sp. 21
Brite
Enzymes [BR:shg01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     Sph21_5042
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5965016..5966083
Genome map
AA seq 355 aa AA seqDB search
MKKWIVLIGLVIVAYACKKADETLPDLDELFPGFLKPGHFPEPVYKFTENEVTEAGFELG
KRLFHEPRLSRNNTIACASCHIQSANFTHHGHDVSHGIDDQLGIRNPMPIMNLAWNKAFF
WDGGVFNLDLLSIVPIENPVEMDERVPNVLIKLRAHPDYPTLFEKAFGSREITSAKMSKA
LSQFMLMAVSDNSKYDQVIRGEKGISFTESEQRGYLFFQNNCSRCHSEPLFTDGDFHDNG
LGRNPAGDEGRYAVTLNPTDKLKFKVPSLRNLKWSAPYMHDGSIYTLSGVLDHYRKFMQH
TENLDMGFRHMDGTRGVAMTDVEKEDLLNFLNTLNDETFVKKQLLSEPGGGFVIN
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatggattgttttaatcgggctggtaattgttgcatatgcctgtaaaaaagcg
gatgaaaccttgccagaccttgacgaattatttcccggttttttaaaaccgggacatttt
cccgaacctgtttacaaattcaccgaaaacgaagtaacggaggctggttttgaattaggt
aagcgcctgttccatgaaccacgtctatctcgcaacaatacgattgcctgtgccagctgc
catattcaatcggccaattttacccaccacggacacgatgttagtcacgggattgacgat
caattgggtatccgtaatcccatgcctatcatgaatctcgcttggaacaaagcgtttttt
tgggatggtggggtgtttaatctcgatctcctttccattgttcctattgaaaacccggtc
gagatggatgaaagggtgccgaacgtactaataaagctgagagcgcacccggattatcct
acactttttgaaaaggcctttggaagcagagagatcacctcggcgaaaatgtctaaagca
ttgtctcagtttatgctaatggcagttagtgataacagcaaatacgatcaggtgatccgc
ggggaaaagggtatctcttttactgagtcggaacagcgtggctacctgtttttccagaac
aattgttctcgctgccatagcgaaccgctgtttactgatggcgattttcatgacaatgga
ctgggacgaaatccagcaggtgacgaggggcgctatgccgtaaccttgaaccctacagat
aaactaaaattcaaggtacccagcttgcgtaatttaaaatggtcggctccctatatgcat
gatggcagtatttatacattgagcggtgtactggaccattaccggaaatttatgcagcat
acggaaaatctggacatgggtttccggcacatggacggaacacgaggggttgctatgaca
gatgtcgagaaggaggatttattgaatttccttaacacattgaatgatgaaacttttgta
aaaaaacaactgctatcggaaccgggcggtggctttgttatcaattaa

DBGET integrated database retrieval system