KEGG   Sphingobacterium sp. 21: Sph21_5117Help
Entry
Sph21_5117        CDS       T01450                                 

Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
shg  Sphingobacterium sp. 21
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:shg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sph21_5117
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sph21_5117
   00052 Galactose metabolism
    Sph21_5117
   00500 Starch and sucrose metabolism
    Sph21_5117
   00520 Amino sugar and nucleotide sugar metabolism
    Sph21_5117
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Sph21_5117
   00524 Butirosin and neomycin biosynthesis
    Sph21_5117
Enzymes [BR:shg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Sph21_5117
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6041697..6042731)
Genome map
AA seq 344 aa AA seqDB search
MTRIPLYLPNKQNGKNVLLLAADIGGTKTSLGTFKVEDAQIKLLREQTFPSRDYLSFDQI
LDEYLRNDVNSPPEVLSIGVAGPVVNNAVKLTNLSWNIDAKMLQQNSGWSKVCILNDLEA
MAYGLAGIAKDDLATLYSGEPEAGNIAILAPGTGLGEAGLFWDGKFYRPFATEGGHSEFS
PRTETDIELFHYLRNESPLISWEHLISGAGIYRIYSFLRDVKGYKEPAWLSEKLTTEDPA
AVVSHTAMRELNDGCVKAMQLFVSYMAREATSLVLKLKATGGLYLGGGIPPKIYPLLRDE
LFRQQFIQSDRMELLLQRIPIHLILKNRTALTGAAYYGAFGKEL
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgacccgtataccgctttatttacccaataaacaaaatggaaaaaatgtcttattgctt
gctgctgatattggagggacaaaaacaagcctaggtacgtttaaggtagaagatgcacaa
attaagttactacgggagcaaacctttccgtcccgagattatttatctttcgatcagatt
ttagatgaatatttaagaaatgatgttaattcaccacctgaagtgttatctattggtgta
gcaggacccgtggtaaataatgccgtaaaattgactaatttatcatggaatattgatgcc
aagatgctgcaacaaaatagcgggtggagtaaagtatgtatattgaatgacctggaagca
atggcttatggtttagcgggaattgcaaaagatgatttggcaacgttatattcgggagaa
cctgaggccgggaatattgctatcctagcaccgggtaccggattgggagaagcagggctt
ttttgggatggaaaattctatcggccttttgctacggaaggaggtcatagcgaattctcg
ccgcgtactgaaacggatatagaactttttcattatttacgaaacgaaagtccgttgatc
agttgggagcatttgatttcgggggccgggatataccgaatttattcctttctacgggat
gtaaaaggctataaagaacctgcttggttgagcgaaaaattaactacggaagaccccgct
gcggtggtaagccacacagcaatgcgtgaattaaacgatggatgcgttaaagccatgcag
ttatttgtaagttatatggctcgagaagccactagtttggttcttaaattgaaagctaca
ggtggtttatacctgggaggggggattcctccaaaaatttatccactcttacgcgatgag
ctgttccggcagcagtttatccaaagtgatcgcatggagcttttattgcagcgtattccc
atacacctaattctaaagaaccgaactgcattgacgggagcagcatattatggagccttt
ggtaaagagctatag

DBGET integrated database retrieval system